KEGG   Edwardsiella tarda FL6-60: ETAF_2324Help
Entry
ETAF_2324         CDS       T02091                                 

Definition
Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ETAF_2324
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAF_2324
  Amino acid metabolism
   00310 Lysine degradation
    ETAF_2324
Enzymes [BR:etd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ETAF_2324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2641469..2642680)
Genome map
AA seq 403 aa AA seqDB search
MSSVEILVPDLPESVADATVATWHKQVGDSIARDEVIVEIETDKVVLEVPAAEAGVLEAI
LEPEGATVTARQLLGRLRPADVSGVAISAGAQAAQATPAERHTAALETGSSDALSPAVRR
LVAEHDVDPSSLQGSGVGGRLTREDVTKHLAGQPSAAPVAAPPQAAAPLSAEREKRVPMT
RLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRSQYGEAFEKRHGVRLGFMSFYIKAV
LEALKRYPEVNAALDGEEVVYHNYFDISIAVSTPRGLVTPVIRDVDTLSMADIEKQIKAL
ALKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVNGQV
VILPMMYLALSYDHRQIDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgtagaaattctggttcccgatctgcctgaatccgtcgccgacgccacggtc
gctacctggcataagcaggtgggcgacagcatcgctcgcgatgaggtcatcgttgagatc
gagacggacaaagtggtcctggaggtgccggcggcggaggccggcgtgttggaggctatt
ctggaaccggagggagcaacggtaacggcgcgccagctgctgggacggctgcgtccggcc
gacgtgagcggcgtcgcgattagcgccggtgcgcaggcggcgcaggcgacgccggccgag
cgccataccgccgccctggagacgggcagcagcgatgccctgagccccgcggtgcgtcgt
ctggtcgccgagcacgacgtggatccgtcgtcgctgcagggcagcggcgtcggcgggcgt
ctgacgcgagaggatgtgaccaagcatctggctgggcagccgagcgcggcgccggtcgcc
gcgccgcctcaggccgccgcgccgctgagcgcggagcgtgagaagcgggtgcccatgacc
cgtctgcgcaagcgggtggccgaacgcctgctggaggcgaagaacagcaccgcgatgctg
accacctttaacgaagtgaacatgaagccgatcatggatctgcgcagccagtacggtgag
gcgtttgaaaaacgccacggcgtgcgcctgggctttatgtctttttatatcaaggcggta
ttggaagcgctgaagcgttatccggaggtgaacgccgcccttgacggcgaagaggtggtc
taccataactacttcgatatcagcattgcggtgtcgacgccgcgcgggctggtgacgccg
gtgatccgcgatgtcgataccctgagcatggcggatattgaaaaacagattaaggcgctg
gcgctgaaggggcgcgacggcaagctgacggtcgaggagctgaccggcggcaactttacc
attaccaacggcggcgtatttggctccctgatgtccacgccgattatcaacccgccgcag
agcgcgatcctgggcatgcatgccatcaaggatcgcccgatggcggtcaacggccaggtg
gtgatcctgccgatgatgtacctggcgctttcgtatgaccatcgtcagattgacgggcgt
gagtccgtgggcttcctggtgacggtcaaagagatgttggaagatccggcgcgtctgctg
ctggatgtgtaa

DBGET integrated database retrieval system