KEGG   Edwardsiella tarda FL6-60: ETAF_2328Help
Entry
ETAF_2328         CDS       T02091                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
etd  Edwardsiella tarda FL6-60
Pathway
etd00020  Citrate cycle (TCA cycle)
etd00190  Oxidative phosphorylation
etd00650  Butanoate metabolism
etd01100  Metabolic pathways
etd01110  Biosynthesis of secondary metabolites
etd01120  Microbial metabolism in diverse environments
etd01130  Biosynthesis of antibiotics
etd01200  Carbon metabolism
Module
etd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
etd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
etd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ETAF_2328
   00650 Butanoate metabolism
    ETAF_2328
  Energy metabolism
   00190 Oxidative phosphorylation
    ETAF_2328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ADM42431
UniProt: A0A0H3DT20
Position
complement(2648308..2648655)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIQDWLLLRASAIIITLYVIYLLAFVVGAGPLTYTLWLDFFSSRITQVF
TLLTLLCILIHAWIGMWQVLTDYVKPLALRLVLQLAIVVVLVVYLVYGTLVVWGI
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcatcggcgctggggcgcaacggtattcaggactggctgctgctgcgc
gcatccgccatcatcatcacgctgtacgttatctatctgctggccttcgtggtcggcgca
ggcccgctcacctatacgctgtggcttgatttcttctcttcgcggatcacccaggtgttt
accctgctgaccctgctgtgcatcctgatccatgcctggatcgggatgtggcaggtcttg
accgactacgtcaagccgctggcgctgcgtctggtgctacagctggcgatcgtggtggtc
ctggtggtctatctggtttacggaacattggttgtgtgggggatatag

DBGET integrated database retrieval system