KEGG   Edwardsiella tarda FL6-60: ETAF_2352Help
Entry
ETAF_2352         CDS       T02091                                 

Definition
Beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ETAF_2352
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ETAF_2352
Enzymes [BR:etd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ETAF_2352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2674306..2676975)
Genome map
AA seq 889 aa AA seqDB search
MMKGYKLSVVATALGMLGVSGVAQADQQLVDSISSQVKVNYAVTDNRGAENGVNCAALGA
DWASCNQAVISLTNDGSAIEGKDWAIYFHNIRQILKSGNDQFKITFVTGDLHKIEPTDKF
KGFAAGERIEIPIVGEYWQLFESDVMPRWYVTSRDAKPKVIANTDTEDLRQFVTPFAGDL
WKRIKDDKNVLMTPENRFAKNADVKTLSAASLRGQIMPTPLKLKVHQQDADLARGVSLDL
TVLNTASADVIKQRLGQLGVKQAQKGYPIKTQIATKAFKGDMAVPGAYQLKIGTKGAEVT
GYDQAGVFYGLQSILSLLPANGSAKIATLDAEDAPRFQYRGIELDVGRNFHSLAAVERLL
DQMAAYKLNKFHFHLTDDEGWRIEIPGLPELTEVGGKRCHDLSEQQCLLPQLGSGPDSNN
NGSGYFTRADYIKLLKYAQARHIEVIPEIDMPAHARAAVVAMEARYNKLKAAGNEKGANE
YRLLDPTDDSNTTSVQFYDRHSYLNPCLDSSKRFVDKVIGEMAQMHREAGQPLTTWHFGG
DEAKNIRLGPGYTDVNKPEPGKGMIDLSKEDKPWAKSQMCQAMIKEGKVADMEHLPSYFA
VEVSKMVKDHGIGKMQAWQDGLKDAKDAKAFATPRVGVNFWDTLYWGGFDSANDWANKGY
EVVISNPDYVYMDFPYEVNPQENGYYWGTRFSDERKIFAFAPDNLPQNAETSVDRDGNYF
SAKSDKPWPGAYGLSAQLWSEVVRTDEMMEYKIYPRIMAVAERAWHQAGWEQPYQAGREY
KGGETHLVDQQALLQDWQRFANLMGQRELAKMDKSGVAYRVPQPGARVVNGTLETNVAMP
GLIVEYSVDGGKQWQRYDAKAKPSVNGEVQVRTASPDGKRFSRVESVKS
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaggatataaactgagcgtagtcgccacggcactgggtatgctgggcgtttcc
ggcgtagcgcaggccgatcagcagctggtggacagcatcagcagccaggtgaaggtgaac
tacgccgtcaccgacaaccgcggcgcggagaacggcgtcaactgtgcggcgctgggcgcc
gactgggcctcctgcaaccaggcggtgatcagcctgaccaacgatggcagcgccatcgag
gggaaagactgggccatctacttccataacatccgtcagatcctgaagagcggcaacgat
cagttcaagatcacctttgtgaccggcgatctgcacaagattgagccgacggataagttc
aagggctttgccgcgggtgagcgcatcgagatccccatcgtcggcgaatactggcagctg
tttgaaagcgacgtgatgccgcgctggtacgtgacctcgcgggacgctaagccgaaggtg
atcgccaacaccgataccgaagatctgcgtcagttcgtgacgccgtttgcgggcgacctg
tggaagcgtatcaaggacgataaaaacgttctgatgacgccggagaaccgctttgccaag
aacgccgatgtgaagaccctgtcggcggccagcctgcgcggccagatcatgccgacgccg
ctgaagctgaaagtgcatcagcaggacgccgatctggcgcgcggcgttagcctggatctg
acggtgctgaacaccgccagcgccgatgttatcaagcagcgtctgggccagctgggcgtg
aagcaggcccagaagggctacccgatcaagacgcagatcgccactaaagcctttaaaggc
gatatggcggtaccgggcgcgtaccagctgaagatcggcaccaagggcgcggaggtgacc
ggttacgatcaggccggggtgttctacggtctgcagtctatcctgtcgctgctgccggcc
aacggcagcgctaagatagccacgctggacgccgaagatgcgccgcgcttccagtaccgc
ggcattgagctggacgtgggccgtaacttccactccctggccgctgtcgagcgcctgctg
gatcagatggcggcgtacaagctgaacaagttccacttccatctgaccgacgatgagggc
tggcgtattgagatcccgggcctgccggagctgaccgaagtcggcggcaagcgctgtcat
gacctgagcgagcagcagtgcctgctgccgcagctgggctctggcccggacagcaacaac
aacggcagcggctactttacccgcgccgactatatcaagctgctgaagtatgcccaggcg
cgccacattgaggtgatccccgagatcgacatgccggcccacgcccgtgcggcggtggtg
gcgatggaggcgcgttacaacaagctgaaggccgccggtaacgagaagggcgccaacgag
taccgcctgctggatccgaccgatgactctaacaccacctcggtgcagttctacgatcgt
cacagctacctcaacccgtgcctggactcctccaagcgctttgtcgacaaagtgattggc
gagatggcccagatgcaccgcgaagccggtcagccgctcaccacctggcactttggcggc
gatgaggcgaagaacatccgcttagggccgggctataccgacgtgaacaagccggagccg
ggcaaggggatgatcgacctgagcaaagaggacaagccgtgggcgaagtctcagatgtgc
caggcgatgatcaaagagggcaaggttgccgacatggagcacctgccgagctacttcgcg
gtcgaagtcagcaagatggtcaaggaccacggcatcggcaagatgcaggcctggcaggat
ggcctgaaggatgccaaggatgccaaggcatttgcgacgccgcgcgtcggggttaacttc
tgggataccctgtactggggtggctttgactcggccaacgactgggccaataaaggctat
gaggtggtgatctccaacccggattacgtctatatggacttcccgtacgaggtcaatccg
caggagaacggctactactggggcacccgcttcagcgatgagcgcaagatctttgccttc
gcgccggacaacctgccgcagaacgccgaaacgtcggtcgatcgcgacggtaactacttc
agcgccaagagcgacaagccgtggccgggcgcctatggcctctctgctcagctgtggagc
gaagtggtgcgtaccgatgagatgatggagtacaagatctatccgcgcatcatggccgtc
gctgagcgtgcgtggcatcaggcgggctgggaacagccgtatcaggccgggcgtgaatac
aagggcggcgaaacccacctggtcgatcagcaggccctgctgcaggactggcagcgcttt
gccaacctgatggggcagcgtgagctggccaagatggacaagtctggcgtggcctaccgc
gtaccgcagccgggtgcccgcgtcgtgaacggcacgctggagaccaacgttgcgatgccg
ggcctgatcgtggagtactccgtcgacggcggtaagcagtggcagcgctatgatgccaag
gcgaagccgagcgtgaacggtgaggtacaggtgcgtaccgcatcgccggacggcaagcgc
tttagccgcgtggagtccgtcaagtcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system