KEGG   Edwardsiella tarda FL6-60: ETAF_2362Help
Entry
ETAF_2362         CDS       T02091                                 

Definition
Asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAF_2362
Enzymes [BR:etd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ETAF_2362
Peptidases [BR:etd01002]
 Cysteine Peptidases
  Family C44
   ETAF_2362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2688764..2690425
Genome map
AA seq 553 aa AA seqDB search
MCSIFGVLDLKTDPQALRKTALEMSRLMRHRGPDWSGIYAGERAILAHERLSIVDVNTGA
QPLYNAQRTHVLAVNGEIYNHQALRERLGDRYAFQTGSDCEVILALYQEYGPDFLDQLRG
MFAFILYDAERDAYLIGRDHLGIIPLYMGHDEHGNLFVASEMKALVPVCRTLREFPAGSA
LWSRDGEIRRYYQRDWFDYAAVEHNPSDTAALRGALEESVKSHLMSDVPYGVLLSGGLDS
SIISAITKKFAARRVEDDERSAAWWPQLHSFAVGLSGAPDLKAAREVADHLGTVHHEIHF
TVQEGMDAIRDVIYHIETYDVTTIRASTPMYLMARKIKAMGIKMVLSGEGADEVFGGYLY
FHKAPNAKEFHDETVRKLLALHMYDCARANKAMAAWGVEARVPFLDKAFLDVAMRLNPRD
KMCGSGRIEKQLLRECFESDLPASVAWRQKEQFSDGVGYSWIDSLKAAAAVQVSDQALAN
ARFRFPYNTPTSKEAYLYRDIFEQLFPLPSAAECVPGGPSVACSSAKAIEWDASLRKMDD
PSGRAVGVHQSAY
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcgatctttggagtgctcgacctaaaaaccgatccgcaggcgctgcgcaagaca
gcgctggagatgtcccgtctaatgcgccaccgcggcccggactggtccggcatctatgcc
ggtgaacgcgccattctggcccatgagcgcctgtctatcgtcgatgtcaacaccggcgcc
cagccgctgtacaacgcgcagcgcacccacgttctggcggtcaacggtgaaatttataac
caccaggcgctgcgcgagcgcctgggcgatcgctatgcgtttcagaccggatccgactgt
gaggtgatcctggcgctgtaccaggagtacggcccggacttcctcgaccagctgcgcggt
atgtttgcctttattctgtatgacgccgagcgggacgcctatctgatcggccgcgatcac
ctggggatcatcccgctgtacatggggcacgatgaacacggtaacctgtttgtcgcctcc
gagatgaaggcgctggtgccggtatgccggacgctgcgcgaattccccgccggcagcgcc
ctgtggagccgcgacggcgagatccgccgctactaccagcgcgactggttcgactacgcc
gccgtagagcacaaccctagcgacaccgccgcgctgcgcggtgcgctggaggagtcggtc
aagagccacctgatgtccgacgtcccctacggggtactgctctccggcggactggattcg
tccattatctccgccatcaccaaaaaatttgccgcccgccgcgtcgaagacgacgagcgc
agcgccgcctggtggccgcagctgcactcctttgccgtcggcctgtcgggagcgccggat
ctgaaggccgcccgagaggtcgccgaccacctcggcacggtacaccacgagatccacttc
accgtccaagagggcatggacgccattcgcgacgtgatttaccacatcgaaacctacgac
gtcaccaccatccgcgcctcgacgccgatgtacctgatggcccgtaaaattaaagcgatg
gggatcaaaatggtgctctccggcgaaggcgccgacgaggtgttcggcggctacctctat
ttccataaggcccccaacgccaaagagttccacgatgagacggtgcgcaagctgctggcg
ctgcatatgtacgactgcgcgcgcgccaacaaggcgatggccgcctggggcgtcgaggcc
cgagtaccgttcctcgacaaggcgtttttagacgtggccatgcgcctcaacccgcgcgac
aagatgtgcggcagcgggcgcatcgaaaagcagctgctgcgcgaatgcttcgagtccgat
ctgccggccagcgtcgcctggcgtcagaaggagcagttctccgacggcgtcggctacagc
tggatagactcgctgaaagcggccgccgccgtccaggtcagcgaccaggcgctggccaac
gcccgcttccgctttccctacaacacgccgaccagcaaagaggcctacctgtaccgcgat
atctttgagcagctgttcccgctgccgagcgccgcggagtgcgtgcccggcggcccctcc
gtcgcgtgctcctccgccaaggccatcgagtgggatgcgtccctgcgtaaaatggacgac
ccctctggccgcgccgtcggcgtacaccagtccgcctactaa

DBGET integrated database retrieval system