KEGG   Edwardsiella tarda FL6-60: ETAF_2438Help
Entry
ETAF_2438         CDS       T02091                                 

Definition
Arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ETAF_2438
Enzymes [BR:etd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ETAF_2438
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ETAF_2438
Lipid biosynthesis proteins [BR:etd01004]
 Fatty acid synthase
  Component type
   ETAF_2438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2769499..2770116
Genome map
AA seq 205 aa AA seqDB search
MVVMILCGLTAARADTLLVLGDSLSAAYRLPEQQGWVARLAQQWQLRTPPLTVINASISG
DTAEQGLLRLPELLQQHRPRWVLIELGANDGLHGIAPDAIAAALSAIIERVQRAGATPLL
MQIRLPPNYGRRYGDAFAAIYPQLAARFGVALLPFYMEAVVGHPDWIQDDGLHPNALAQP
FIADWMAQRLLPQLTRAENGAPSIN
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcatgatcctgtgtggcctgacggcggcccgtgccgatacactgctggtgctg
ggagacagcctgagcgccgcctatcgcctgccggagcagcagggctgggttgcccgcctg
gcccagcaatggcagctgcgcaccccgccgctgacggtgatcaacgccagcatcagcggc
gataccgccgagcaggggctgctgcgcctgccggagctgttgcagcagcaccggccgcgc
tgggtgctgattgaactgggggccaacgatgggctgcacggcattgcgcccgacgccatc
gccgctgcgctgtccgcgatcatcgagcgggtgcagcgggccggcgccaccccgctgctg
atgcagatccgcctaccgcccaactacggtcggcgctacggcgacgcctttgcggcgatc
taccctcagctggccgcgcgctttggcgtcgcgctgctgccgttttatatggaagcggtg
gtcggccaccccgactggatccaggatgacggcctgcaccccaacgcactggcccagccg
tttatcgccgactggatggcgcagcgcctgctgccgcagctaacgcgcgcggagaacggc
gcgccgtctattaattaa

DBGET integrated database retrieval system