KEGG   Edwardsiella tarda FL6-60: ETAF_2659Help
Entry
ETAF_2659         CDS       T02091                                 

Gene name
dsbC
Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
etd  Edwardsiella tarda FL6-60
Brite
Enzymes [BR:etd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ETAF_2659 (dsbC)
Secretion system [BR:etd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ETAF_2659 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3035081..3035797)
Genome map
AA seq 238 aa AA seqDB search
MKKSVIWLALLAASFSGLARADDAAIQQSLKKLGIQQAQIQASPVAGLKTVFSEGGVLYV
TDDGKHILQGPMYDVSGAVPENVTNQLLMKRLDALAPEMIVYKAPKQKYVITVFTDITCG
YCHKLHSQIKEYNDLGITVRYLAFPRQGLDSKAEKDMQSIWCMADRRKAFDDALKGEAIS
PATCDVNIKSHYELGVQFGIQGTPAIVLSNGMVIPGYQGPKEMLAMLDAQAQMSQKKG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagcgtgatttggttggcattactggcggcatccttcagcggcctggcccgg
gcagatgatgccgcgatccagcagtccctgaagaagctggggatccagcaggcgcagatc
caggcgtcgccggtggccggtctgaagacggtcttcagcgagggcggcgtgctgtatgtc
acggacgatggtaagcatatcctgcaggggccgatgtatgacgtcagcggcgcggtgccg
gaaaacgtcaccaatcagctgctgatgaagcgcctggacgcgctggcgccggagatgatt
gtctataaggcaccgaagcagaagtatgtgatcaccgtctttaccgatattacctgcggc
tactgccataagctgcactcccagattaaggagtacaacgatctggggatcaccgtgcgc
tacctcgccttcccgcgccaggggctggactccaaggcggagaaggatatgcagtcgatc
tggtgtatggcggatcgccgcaaggccttcgacgacgcgctgaagggggaggcgatttca
ccggcgacctgtgatgtgaacatcaagtctcactatgagctgggcgtgcagtttggcatt
caggggacgccggcgatcgtgctgagcaacgggatggtgatccctggctatcaggggccg
aaagagatgctggcgatgctggatgcccaggcgcagatgagccagaagaaaggttaa

DBGET integrated database retrieval system