KEGG   Edwardsiella tarda FL6-60: ETAF_2795Help
Entry
ETAF_2795         CDS       T02091                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:etd00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:etd00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:etd03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:etd03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:etd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3198101..3198550
Genome map
AA seq 149 aa AA seqDB search
MKQATFYLLEQPQAADAPDDVETLACDLACQHWRAGKRVLLACASQEQALRLDEALWARD
PQQFVPHSLAGEGPRFGAPVELSWPGKRGSAPRELLISLLPTFADFATAFHEVIDFVPYE
DALKQLARERYKAYRSVGFHLTTATPPTH
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcaaccttttatttgctggagcagccccaggcggcagacgcgccggacgat
gtagaaacgctggcctgcgatctggcctgccagcactggcgcgccggtaaacgggtgctg
ctggcctgcgccagccaggagcaggcgctgcgcctggacgaggcgctgtgggcgcgcgat
ccgcagcagttcgtgccgcacagcctggccggagaggggccgcgcttcggcgcgccggtg
gagctgtcctggccgggcaaacgcggcagcgcgccgcgcgagctgttaatcagcctgctg
ccgacgttcgcggattttgccaccgctttccatgaagtgatagacttcgtgccttacgaa
gacgcattaaagcagttggcgcgcgaacgctataaagcctatcgcagcgtcggctttcac
ttgaccacggcgacgccgccaactcactga

DBGET integrated database retrieval system