KEGG   Edwardsiella tarda FL6-60: ETAF_2995Help
Entry
ETAF_2995         CDS       T02091                                 

Definition
GH-13-type 1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:etd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3418900..3421110
Genome map
AA seq 736 aa AA seqDB search
MSVLPSTHKIQQLLAGQCADPFALLGMHTTAKGLTVRALMPEAESVQVVDRKNGRTLATL
ERIHEGGFFCGLVPRRKNPFPYLLRVTWANHQQLLEDPYRFGPLLGEIDNWLLKEGTHLR
PYERLGAHLTQLADIRGVSFAVWAPNAQRVSVVGNFNVWDGRRHPMRLRRESGIWELFIP
GVEAGELYKFELIDARGERVLKADPYAFEAQMRPDTASLVAPLPEKSAISAQRSAANGFS
APISIYEVHLGSWRRHSDNGYWLSYREMAEQLIPYVKEMGFTHIELLPINEHPFDGSWGY
QPLGLYAPTRRYGTPQEFREFIDVAHAAGINVLLDWVPGHFPSDEWGLANFDGTALYEYA
DPREGFHQDWNTLIYNYGRYEVRNFLAGNALFWQERYGIDGLRVDAVASMVYRDYSRAAG
EWVPNCYGGNQNLEAIEFLRYTNRTLGEQHPGSVCMAEESTDFPGVTLPPDAGGLGFHFK
WNMGWMHDTLNYMKHDPVYRKYHHNLMTFGLLYAWSENFVLALSHDEVVHGKGSLLDKMP
GDAWQKFANLRAYYGFMWAHPGKKLLFMGGEFAQGREWNHESSLDWHLLEGEDNWHNGVQ
RLVRDLNLCYRSCGALHRWDCDARGFRWRVVDDDQNSVFAFVRRDDMGNEVLVVSNFTPV
PRHHYRIGVDLPGRYREILNTDSSHYHGSNSGNQGGVLSEAVGSHGCEYSVQLTLPPLST
LYLCLDNGDGDDAQAG
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtacttcccagcactcacaagatccaacaactgctcgccggccagtgcgccgat
cccttcgctctgctggggatgcacacgaccgctaaagggctgaccgtgcgggcgctgatg
cccgaggcagaatcggtacaggtggtcgaccgtaaaaacgggcgcacgctggccacgctg
gagcgtatccatgagggcggtttcttctgcggcctggtgccgcggcgtaagaatcccttc
ccttatctgctgcgcgtcacctgggccaatcatcagcagctgctggaagatccctaccgt
ttcgggccgttgttaggcgagatcgataactggctgctcaaagagggtacccatctgcgt
ccctatgaacgactgggcgcccacctgacccagctggccgatatccgcggcgtcagcttc
gccgtctgggcacccaacgcccagcgcgtctcggtggtcggcaactttaacgtctgggac
gggcgccgccatccgatgcgcctgcgtcgggaaagcggtatctgggagctgttcatcccc
ggcgtagaggcgggtgagctgtacaagtttgagctgatcgacgcccgcggcgagcgggtg
ctgaaagccgatccctacgcctttgaagctcagatgcggccggataccgcctcgctggtc
gctccgctaccggaaaaaagcgccatcagcgcccagcgcagcgccgccaatggcttcagc
gccccgatctccatctatgaggtacacctcggctcctggcgacgccacagcgacaacggc
tactggctgagctaccgggaaatggccgagcagctcatcccctacgtcaaagagatgggc
tttacccatatcgagctgctgccgatcaatgagcacccctttgacggctcctggggctat
cagccgctggggctatacgcgccgacccgacgctatggcacgccgcaggagttccgtgaa
tttatcgacgtcgcccacgccgccgggatcaacgtcctgctcgactgggttcccggccac
tttcccagcgacgagtgggggctggctaacttcgacggcacggcgctgtatgaatacgcc
gatccgcgcgaaggcttccaccaagactggaataccctgatctacaactatggccgctat
gaggtgcgtaacttcctggccggcaacgccctcttctggcaggagcgctatggcatcgac
ggcctgcgcgtcgacgccgtggcctccatggtctaccgcgactacagccgcgccgcgggc
gaatgggttcccaactgctacggcggaaaccagaatctggaggccatcgagttcctacgc
tataccaaccggaccctgggcgagcaacaccccggcagcgtctgtatggccgaagagtcc
accgactttcccggcgtcaccctgccgccggacgccggcggcctgggcttccacttcaag
tggaatatgggctggatgcacgacaccctcaactacatgaagcacgatccggtctatcgc
aaatatcaccacaatctgatgaccttcggcctgctgtatgcctggagcgaaaactttgtg
ctggccctctcccacgacgaagtcgtgcacggcaagggctcgctgctggataaaatgccc
ggtgacgcctggcagaaatttgccaacctgcgcgcctactacggctttatgtgggcgcat
cccggtaaaaagctgctgtttatgggcggggagtttgctcaggggcgcgaatggaaccac
gagtccagcctggactggcacctgctagagggcgaagacaactggcacaatggcgtccag
cggctagtacgggatctgaacctctgctatcgcagctgcggcgcactgcaccgctgggac
tgcgacgcgcgtggcttccgctggcgagtggtcgatgacgatcagaactcggtcttcgcc
tttgtccgccgcgacgatatgggcaacgaagtgctggtggtcagtaactttacgccggtc
ccgcgtcatcactaccgtatcggcgtcgatctgccggggcgctatcgcgaaattctcaat
accgactccagccactaccacggcagcaacagcggtaatcagggcggcgtgctcagcgag
gcggtgggcagccacggctgtgagtactccgtccagctgaccctaccgccgctgtcgacg
ctctatctgtgtctggataatggggacggagacgatgctcaggccgggtaa

DBGET integrated database retrieval system