KEGG   Edwardsiella tarda FL6-60: ETAF_3104Help
Entry
ETAF_3104         CDS       T02091                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ETAF_3104
Enzymes [BR:etd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ETAF_3104
Exosome [BR:etd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETAF_3104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3554519..3556027
Genome map
AA seq 502 aa AA seqDB search
MTTEQKYIVALDQGTTSSRAVILDHDANIISASQREFEQIYPKAGWVEHDPMEIWATQSS
TLTEAMAKADIESDQIAAIGITNQRETTIVWEKETGKPVYNAIVWQCRRTADICEKLKRD
GLEEYIRHNTGLVVDPYFSGTKVKWILDHVDGARERAQRGELLFGTVDTWLVWKMTQGRV
HVTDYTNASRTMLFNIHTLDWDERMLEVLDIPRAMLPQVRASSEIYGKTNIGGKGGTRIP
IAGIAGDQQAALFGQLCVQPGMAKNTYGTGCFLLMNTGKEAVPSQHGLLTTIACGPRGEV
NYALEGAVFIGGASIQWLRDELKLINDAADSEYFATKVKDSNGVYVVPAFTGLGAPYWDP
YARGAIFGLTRGVNNNHIIRATLESIAYQTRDVLDAMQADANTRLQSLRVDGGAVANNFL
MQFQSDILGTRVERPAVLEVTALGAAYLAGLAVGYWSDLEELSSKASIEREFRPGIETVE
RNYRYSGWKKAVARAQAWEDHD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgaacaaaaatacattgtcgctcttgaccagggcaccaccagctcccgcgcc
gtgatcctcgaccacgatgccaatatcatcagcgcctcccagcgcgagttcgaacagatt
taccccaaggccggctgggtggagcacgacccgatggagatctgggcgacccagagctct
accctcacggaggcgatggccaaagccgatatcgaatccgatcagattgccgccatcggc
atcaccaaccagcgtgaaaccactatcgtctgggaaaaagagaccggtaaaccggtctac
aacgccatcgtctggcagtgccgtcgtaccgccgatatctgtgaaaagctcaagcgcgac
ggactggaggagtacatccgccacaacaccggcctggtggtcgacccctacttctccggc
accaaggtgaagtggatcctggaccatgtcgacggcgcccgcgaacgcgcccagcgcggc
gaactgctgttcggcaccgtcgatacctggctggtatggaagatgacccaagggcgggta
cacgtcaccgactacaccaacgcctctcgcaccatgctgttcaacatccacacgctggac
tgggatgagcgcatgctggaggtgctggatatcccgcgcgcaatgctgccgcaggtacgc
gcctcttccgaaatctatggaaaaaccaacatcggcggcaagggtggaacccgtatccct
atcgccggtatcgccggtgaccagcaggcggcgctgtttggccaactgtgtgtgcagccg
gggatggcgaagaacacctacggcaccggctgcttcctgctgatgaacaccggtaaagag
gcggtaccgtcacagcacggcctgctgaccaccatcgcctgtggtccgcgcggcgaggtg
aactacgcactggagggggcggtcttcatcggcggcgcctcgattcagtggctgcgcgac
gagctgaagctcatcaacgatgcggcggactccgagtactttgctaccaaggtaaaagac
agcaatggcgtctacgtggtgccggcctttaccggcctgggcgccccttactgggacccc
tatgcccgcggcgccatctttggcctgacccgcggcgtcaacaataaccacatcatccgc
gcgaccctggagtccatcgcctaccagacccgcgacgtactggatgccatgcaggccgac
gccaatacccgtctgcagtccctgcgcgtcgacggcggcgcggtcgctaacaacttcctg
atgcagttccagtcagacatcctcgggacgcgggttgaacgcccggcggtcctggaggtc
acggcgctcggcgcggcctatctggccggtctggccgtcggctactggagcgatctggag
gagctgagcagcaaggccagcattgagcgtgagttccgccctggcattgaaaccgtcgag
cgcaactatcgctacagcggctggaagaaagcggtggcgcgcgcgcaggcctgggaagat
cacgactga

DBGET integrated database retrieval system