KEGG   Edwardsiella tarda FL6-60: ETAF_3111Help
Entry
ETAF_3111         CDS       T02091                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ETAF_3111
   01230 Biosynthesis of amino acids
    ETAF_3111
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAF_3111
   00051 Fructose and mannose metabolism
    ETAF_3111
   00562 Inositol phosphate metabolism
    ETAF_3111
Enzymes [BR:etd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ETAF_3111
Exosome [BR:etd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ETAF_3111
  Exosomal proteins of bladder cancer cells
   ETAF_3111
  Exosomal proteins of melanoma cells
   ETAF_3111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3561525..3562289
Genome map
AA seq 254 aa AA seqDB search
MRQPLVMGNWKLNGSRHMVHELVAALRGELSDVANCDVAIAPPAVYLDMAAHELAGSRIA
LGAQDVGINASGAFTGEISAAMLKDIGAKYIIIGHSERRTYHKEGDAFIAEKFAALKEAG
LIPVLCIGETEAENEAGKTEEVCARQLDAVLKTMGAQVFKGAVIAYEPIWAIGTGKSATP
EQAQAVHKFIRDHVAKHDAEAAQEVIIQYGGSVNAANAADLFKQPDIDGALVGGASLKAD
AFATIVRAAAAAKA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaccattagttatgggtaactggaaactgaacggtagccgccacatggttcac
gaactggttgccgccctgcgcggtgaactgagcgacgtagcaaactgcgatgtcgccatc
gccccgccggcagtctatctggatatggccgcccatgaactggccggtagccgtatcgcc
ctcggtgcccaggacgtcggtatcaatgcctccggcgcattcaccggtgaaatctccgcc
gcgatgctgaaagacatcggtgccaaatacatcatcattggccactcagagcgccgtacc
taccacaaagaaggcgacgcgttcatcgcagagaaatttgccgcgctgaaagaagccggt
ctgatcccggtgctgtgcatcggtgagacggaagctgaaaacgaagccggtaaaacggaa
gaagtctgcgcccgccagctggatgccgtactgaaaaccatgggtgctcaggtgtttaaa
ggcgccgttatcgcctatgaaccgatatgggccatcggtaccggtaagtctgccactccg
gaacaggctcaggcggtacacaaatttatccgcgatcacgttgccaagcacgacgctgaa
gccgcacaggaagtcatcatccagtacggcggctcagtcaacgcagccaatgcggccgat
ctgttcaagcagccggacatcgacggtgcactggtcggcggggcctctctgaaggccgac
gcattcgccaccatcgtacgcgccgccgctgccgctaaagcctaa

DBGET integrated database retrieval system