KEGG   Edwardsiella tarda FL6-60: ETAF_3173Help
Entry
ETAF_3173         CDS       T02091                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
etd  Edwardsiella tarda FL6-60
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:etd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETAF_3173
Enzymes [BR:etd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ETAF_3173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3640051..3640980)
Genome map
AA seq 309 aa AA seqDB search
MQTGKLVVLGSINADHILKVEHFPRPGETLTGQGYQVAFGGKGANQAVAAGRSGADIAFI
ACVGADDIGERIRTQLACDGIDVHAVERVDGESTGVALIFVNQDGENVIGINAGANHALT
PQYLSRHRALVAQADALLMQLESPLETVEAAAALAREHQTKVILNPAPARTLPDSLLRLV
DVITPNETEAERLTGIRVHDDESARQAAAVLHGKGIATVMITLGRRGVWVSQEGHGGVIP
GFRVNAIDTIAAGDTFNGALLTALLEGNTLSAAVRFAHAAAAIAVTREGAQPSVPWRREI
DAFLQTHQE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaggcaaactggtcgtattaggcagtatcaatgccgatcacattcttaaggtc
gaacattttccccgccccggtgaaaccttaaccggacaggggtatcaggtggcattcggc
ggtaaaggggccaatcaggccgttgccgccgggcgcagcggcgcggatattgcctttatt
gcctgtgttggcgccgatgatatcggcgaacggatccgaacccagctggcctgtgatggg
atcgacgttcacgccgtggagcgcgtcgacggcgaaagcaccggcgtggcgctgattttt
gtcaatcaggatggggagaatgtcattggtattaacgccggtgctaatcatgcgctgacg
ccgcagtatctatcccgccatcgggcgctggtggcgcaggccgatgcgctgctgatgcag
ctggagtcgccgctggagaccgttgaagccgccgcggcgctggcccgagagcaccagacc
aaggtgattttgaacccggcaccggcgaggacgctgccggattctctgctgcggctggtg
gatgtcatcacccccaatgagaccgaggctgaacgcctgaccggtattcgggttcacgac
gatgagagcgctcgccaagccgccgccgtattgcatggcaaaggtattgcgaccgtgatg
atcacgctcggtcgccgcggcgtgtgggtcagccaagagggacatggtggggtgatcccg
ggatttcgggttaacgccatcgataccattgccgccggggataccttcaacggggcgctg
ctaaccgctctgctggaggggaatacgctgtctgccgccgtgcgctttgcccatgccgcc
gcggcgatcgccgtgacgcgcgagggtgcgcagccctctgtcccttggcgccgtgagatc
gatgccttcctgcagacgcatcaggagtaa

DBGET integrated database retrieval system