KEGG   Edwardsiella anguillarum: ETEE_4074Help
Entry
ETEE_4074         CDS       T03245                                 

Gene name
atoB
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ete  Edwardsiella anguillarum
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ete00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETEE_4074 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    ETEE_4074 (atoB)
   00640 Propanoate metabolism
    ETEE_4074 (atoB)
   00650 Butanoate metabolism
    ETEE_4074 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    ETEE_4074 (atoB)
   00072 Synthesis and degradation of ketone bodies
    ETEE_4074 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ETEE_4074 (atoB)
   00310 Lysine degradation
    ETEE_4074 (atoB)
   00380 Tryptophan metabolism
    ETEE_4074 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ETEE_4074 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ETEE_4074 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ETEE_4074 (atoB)
Enzymes [BR:ete01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ETEE_4074 (atoB)
Exosome [BR:ete04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ETEE_4074 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4089869..4091053
Genome map
AA seq 394 aa AA seqDB search
MKNCVIVSAVRTAIGSFNGALSQMGAVDLGATVIRAALERARLDPQRVDEVIMGNVLQAG
LGQNPARQALLRAGLSEAVCGFTVNKVCGSGLKSVALAAQAIQAGQALALVAGGMENMSQ
APYLLSAKARWGYRLGDGTLTDVILQDGLLCATHGYPMGITAENIAREYGISREMQDALA
LHSQQKAARALQRGAFQAEIVPVSVTSRKKTTLVERDEFPKADSTAEGLSTLRPAFDKAG
SVTAGNASGINDGAAALVVMEESAARAAGLTPLARIKGYASAGVAPALMGMGPVPAAQKA
LRQCGLQIADIDLIEANEAFAAQFLAVGKTLGLDAEKVNVNGGAIALGHPIGASGARILV
TLLHALAARDKTLGLATLCIGGGQGIALIVERIG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtcatcgtcagcgcggtacgcaccgccatcggcagcttcaacggcgcc
ctgtctcagatgggtgccgtcgatctgggtgccacggtcatcagggccgccctggaacgc
gcccgcctcgacccgcagcgggtggatgaggtgatcatgggcaacgtgctgcaggccggc
ctggggcaaaacccggcgcgccaggcgctgctgcgggccggcctcagcgaggcggtctgc
ggttttaccgtcaacaaggtctgcggatcggggcttaagagcgtggcgctggccgcccag
gccattcaggcggggcaggcgctggcgctggtcgccggcggcatggaaaacatgagtcag
gcgccgtacctgctgagtgcaaaggcgcgctggggctaccgcctcggcgacggcacgctg
accgacgtcatcctgcaggatggtctgctgtgcgccacccacggctacccgatggggatc
accgccgaaaacatcgcccgcgaatacggcatcagccgtgagatgcaggacgcgctggcc
ctgcactcccagcaaaaggcggcccgcgccctccagcgcggcgcgtttcaggccgagatc
gtcccggtcagcgtgacatcgcgtaaaaaaaccaccctcgttgagcgcgacgaattcccc
aaagccgactccacggcggaagggctttccaccctgcgcccggcgttcgataaagccggc
agcgtcaccgccggcaacgcctcggggatcaacgacggcgcggcggcgctggtggtgatg
gaggaaagcgccgcccgggcggcggggctgacgccgctggcgcggattaagggctatgcc
agcgccggcgtcgcgccggcgctgatggggatggggccggtccccgccgcccagaaggcg
ctgcgccagtgtgggctgcagatagccgacatcgatctgatcgaggccaatgaagccttt
gccgcgcaattcctggccgtcggcaagacgctggggctggatgccgagaaggtgaacgtc
aacggcggcgccatcgcgctgggtcaccccatcggcgccagcggcgcccggatcctggtc
accctgctgcacgcgctcgccgcccgagacaaaaccctggggctggcgacgctgtgcatc
ggcggcggccaggggatcgccctgatcgtggagaggatcggctaa

DBGET integrated database retrieval system