KEGG   Edwardsiella tarda EIB202: ETAE_0130Help
Entry
ETAE_0130         CDS       T01121                                 

Gene name
pldA
Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:etr00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:etr00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:etr00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
131036..131923
Genome map
AA seq 295 aa AA seqDB search
MNACKKYLMAGVAALPLVAQAAPSASESGAAPALSDNEGVIANMLRHYDNPFTLYPYSTN
YVLYTQTSDINKEAISSYDWGDQAKKNEIKFQISLAFPIWRGIAGDNSVLGAAYTQQSWW
QAFNRSESSPFRETNYEPRLFLGWATDYPLFGGWVLRDIEAGGVHQSNGRSDPTSRSWNR
VYTRFLAQNGNFQVQLMPWYRIPESPNKDDNPDITKYMGYYEAEMGYRLGESVFSLRGRY
NWNSGYGAAELGWSYPLTRHVRFYTQLFSGYGESLIDYNFRQTRFGVGVMLNDIL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgtgtaaaaaatatttaatggccggagtggcggcgttgccactggtggcgcag
gcggcgccgagtgcgagtgaaagcggtgcggctcccgcgctgagtgataatgagggggtg
atcgccaacatgctgcggcattacgataacccgtttacgctctatccttactccaccaac
tatgtgctgtatacccagaccagcgatatcaataaagaggccatcagctcttacgactgg
ggcgatcaggctaaaaagaacgagattaagtttcagattagcctggcattccccatctgg
cgcggtatcgccggcgataactcggtgctcggcgcagcctacactcagcagtcctggtgg
caggcctttaaccgcagcgaatcttctccgtttcgcgaaaccaactatgagccgcgcctg
tttttaggctgggcgaccgactatcccttgttcggcggctgggtgctgcgcgatattgag
gcgggcggagtgcaccagtctaatggccggtcggatccgacctcgcgcagctggaaccgc
gtctatacccgttttctggcgcagaacgggaattttcaggttcagctgatgccgtggtat
cgcattccggagagtccgaacaaggacgataaccccgatatcaccaagtacatgggctac
tacgaagcggagatgggctatcgcctgggcgagagcgtcttcagcctacgtgggcgctac
aactggaacagcggctatggcgcggccgagctgggctggagctatccgctgacccgccac
gtccgtttctatacccagctgttcagcggctacggcgagtcgttaatcgactataacttc
cgccagacccgcttcggcgtcggcgtcatgctgaacgatatcctgtaa

DBGET integrated database retrieval system