KEGG   Edwardsiella tarda EIB202: ETAE_0154Help
Entry
ETAE_0154         CDS       T01121                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:etr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
159867..160889
Genome map
AA seq 340 aa AA seqDB search
MSYAFPGAFPGRRLRRLRRHDFSRRLCAENVLTVDDLIYPVFVMEGNNHQEAVSSMPGVQ
RMTIDVLVREAEAVAKLGVPVLSLFPVVGTDKKSLYAEEAYSSDGLVQRAVRALKDAVPE
LGILTDVALDPYTTHGQDGVIDEDGYVVNDITKEILVRQALSHAEAGADIVAPSDMMDGR
IGAIRSMLESQKLVNTQIMAYSAKYASCYYGPFRDALGSSGNLKGGNKKTYQMDPANGDE
ALQEVAQDLQEGADMVMVKPGMPYLDVLRRVKDTFGVPTFAYQVSGEYAMHMAAIQNGWL
QEKPAIMESLICFKRAGADGVLTYFAKRVAQWLHDAEMTR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgagctatgcatttccaggcgcctttccggggcgtcgcctgcgccgtctgcgccggcat
gattttagtcgccgtctgtgtgccgaaaacgtgctgacggttgacgatctgatctatccg
gtgtttgtgatggaggggaacaaccatcaggaggcggtctcctccatgccgggggttcag
cgcatgaccatcgatgtcctggttcgtgaggccgaggccgtcgctaagctgggcgtgccg
gtgctgtcgctgttcccggtggtcggtacggataaaaaatcgctgtatgccgaagaggcg
tacagcagcgatggtctggtgcagcgcgcggtgcgggctctgaaggatgcggtgcctgag
cttggcatcttaaccgacgtcgcgctggatccgtatacgacgcacggccaggatggcgtg
atcgatgaggacggctacgtcgtcaacgatatcacgaaagagatcctggtgcgtcaggcc
ttatcccatgccgaggccggtgccgatatcgtggcgccgagcgatatgatggatggccgc
attggcgctatccgcagcatgctggagagccaaaagctggtcaatacccagatcatggct
tactccgcgaagtatgcctcttgctactacggtccgttccgcgatgcgctgggctcctct
gggaacctgaagggcggcaacaagaaaacctatcagatggacccggctaacggggatgag
gcgctgcaggaggtggctcaggatctgcaggagggggccgatatggtgatggttaaacca
ggtatgccgtatctggacgtattacgccgagtgaaagatacctttggcgtgccgaccttc
gcctatcaggtctccggtgagtatgccatgcatatggctgcgatccagaacggttggctg
caggagaagccggcgatcatggagtccctgatttgcttcaagcgggcgggcgccgatggc
gtgctgacctattttgccaagcgtgtggcacagtggctgcatgatgcagagatgacgcgc
tga

DBGET integrated database retrieval system