KEGG   Edwardsiella tarda EIB202: ETAE_0290Help
Entry
ETAE_0290         CDS       T01121                                 

Gene name
fucI
Definition
(GenBank) L-fucose isomerase
  KO
K01818  L-fucose/D-arabinose isomerase [EC:5.3.1.25 5.3.1.3]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00051  Fructose and mannose metabolism
etr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ETAE_0290 (fucI)
Enzymes [BR:etr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.3  D-arabinose isomerase
     ETAE_0290 (fucI)
    5.3.1.25  L-fucose isomerase
     ETAE_0290 (fucI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fucose_iso_N1 Fucose_iso_N2 Fucose_iso_C
Motif
Other DBs
NCBI-ProteinID: ACY83137
UniProt: D0ZAH8
Position
complement(317411..319192)
Genome map
AA seq 593 aa AA seqDB search
MNKQHSLPKVGIRPAIDGRRMGVRESLEAQTMEMAQATARLISEQLRHPCGAPVECVIAD
TCIAGMAEAAACEEKFSRSNVGLTITVTPCWCYGSETIDMDPLRPKAIWGFNGTERPGAV
YLAAALAAHSQKGIPAFSIYGHDVQDSGDDSIPADVQQKLLRFTRAGLAVAGIKGKSYLS
LGGVSMGIAGSIVDHDFFESWLGMKVQAVDMTELRRRIDNQIYDQDELALALEWADAHFR
YGPDLNAEQYRRSPEENRRVLRESLLMAICIRDMMQGNPKLAERGWEEEALGYNAVAAGF
QGQRHWTDQYPNGDTAEALLNSAFDWHGVRRPLVVATENDSLNGVAMLFGHMLTGTAQIF
ADVRTYWSPQAVERVTGQRLEGLAEHGIIHLINSGSAALDGTCRQQDAEGHPTIKPHWQI
SQQEADACLAATEWCPAIHEYFRGGGFSSRFLTRGGVPFTMSRVNLIKGVGPVLQIAEGW
SVELPEEMHDILDNRTNATWPTTWFVPRLTGNGPFKDVYSVMANWGANHGVLTIGHVGAD
LITLASMLRIPVCMHNVTDDAIYRPSAWAAHGMDSEGQDYRACQNYGPLYKRA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcaacacagcctgccgaaagtaggtatccgtccggccatcgatggccgccgt
atgggcgttcgcgaatcgctggaggcacagaccatggagatggcgcaggcgaccgcccgc
ctgatcagcgaacagctgcgccacccctgcggcgcccccgtcgaatgcgtgatcgccgat
acctgcatcgccggcatggccgaagccgccgcctgcgaagagaaattcagccgcagcaac
gtgggtctgaccattaccgtgaccccctgctggtgctacggcagcgaaaccatcgacatg
gatccgctgcgtcccaaggccatctggggcttcaacggcaccgagcgccccggcgcagtc
tatctggccgccgcgctggccgcccacagccagaaagggatcccggccttctccatctat
ggccatgacgtgcaggactccggcgatgacagcatcccggccgacgtgcagcagaagctg
ctgcgctttacccgcgccgggctggcggtggccggaatcaaagggaaaagctacctgtcg
ctgggcggcgtgtcgatgggcatcgccggctccatcgtcgatcacgacttctttgagtcc
tggctgggcatgaaggtgcaggccgtcgatatgaccgagctgcgccgccgcatcgataac
caaatctatgaccaagacgagctggccctggcccttgagtgggctgatgctcacttccgc
tacggcccggatctcaacgccgagcagtatcgtcgctcgccggaggagaaccgccgcgtg
ctgcgcgaaagcctgctgatggcgatctgcatccgcgacatgatgcagggcaacccgaag
ctggccgaacggggctgggaggaggaggcgctgggctataacgccgtggccgccgggttc
caagggcagcgccactggaccgatcaataccccaacggcgacaccgccgaagcgctgctc
aacagcgcctttgactggcacggcgtacgccgtccgctggtggtggcgaccgaaaatgac
agcctcaacggcgtcgccatgctgttcggccacatgctcaccggcaccgcccagatcttt
gccgacgtccgcacctactggtcgccgcaggcggtcgagcgcgtcaccggccagaggctg
gaggggctggccgagcacggcatcatccacctgatcaactccggctccgccgcgctggac
ggcacctgccgtcagcaggacgccgaggggcacccgaccatcaagccacactggcagatc
agccagcaggaggccgacgcctgcctggccgcgacggagtggtgcccggccatccacgaa
tacttccgcggcggcggcttctcctcccgcttcctgacccgcggcggcgtccccttcacc
atgagccgcgtcaacctgatcaagggcgtcgggccggtgctgcagatcgccgaaggctgg
agcgtcgagctgccggaggagatgcacgatatcctcgacaaccgcaccaacgccacctgg
ccgaccacctggttcgtgccgcgcctgaccggcaatggcccgttcaaggatgtctactcg
gtgatggccaactggggcgccaaccacggggttctgaccatcggccacgtcggcgcggac
ctgattaccctggcctccatgctgcgcattccggtatgcatgcacaacgtcaccgatgac
gccatctaccgtccctccgcttgggccgcccacgggatggacagcgaaggtcaggactac
cgcgcctgccagaactacggcccgctgtacaagcgcgcctga

DBGET integrated database retrieval system