KEGG   Edwardsiella tarda EIB202: ETAE_0373Help
Entry
ETAE_0373         CDS       T01121                                 

Gene name
cysQ
Definition
3-phosphoadenosine 5-phosphosulfate (PAPS) 3-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ETAE_0373 (cysQ)
Enzymes [BR:etr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ETAE_0373 (cysQ)
Transfer RNA biogenesis [BR:etr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ETAE_0373 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
415696..416436
Genome map
AA seq 246 aa AA seqDB search
MLEQICQLARDAGAAIMTVYQGDQPLALAYKGDQSPVTAADLAAHEIIKAGLLRITPAIP
LLSEEAPPAWPQRRDWQRYWLVDPLDGTKEFLQRNGEFTVNIALIEQGVPTLGVVYVPTS
GVLYCACDGKAWKEQDGVRMEIGVRNAIPPLVVISRSHGDAELTDYLQQLGEHQTMMVGS
SLKFCLVAEGIAQLYPRFGPTHIWDTAAGHAIAFAAGAQVRDWQGKTLSYIPAESLLNPG
FRVSLY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcagatttgtcagctggcgcgcgatgcgggggcggcgataatgacggtatat
cagggcgatcagccgctggcgctggcctataagggcgatcagtccccggtcacggccgcc
gatctggcggcgcatgagataatcaaggcaggattactgcgcattaccccggcgatcccg
ctgctgtcggaggaggcgccgccggcctggccgcagcggcgcgactggcagcgttattgg
ctggtcgatccgctggatggcaccaaggagtttttgcagcgcaacggtgagtttaccgtc
aatattgcgctgatcgaacagggggtacccacgctgggagtcgtctacgtgccgaccagc
ggtgtgctgtactgtgcctgcgacggtaaggcctggaaagagcaggatggggtgcgcatg
gagatcggggtacgtaacgcgatccccccgctggtggtgatcagccgttcacacggcgac
gcggagctgacggactatctgcagcagctgggcgaacaccagacgatgatggtgggatca
tcgctgaagttttgtttggtggcggaggggatcgcgcagctttatccgcgctttgggccg
acccatatctgggatacggcggccggtcatgccatcgctttcgccgcgggagctcaggtg
cgagactggcagggtaaaacgctaagctatatccccgcggaatcattgttgaatccgggg
ttccgggtatcgctgtattaa

DBGET integrated database retrieval system