KEGG   Edwardsiella tarda EIB202: ETAE_0487Help
Entry
ETAE_0487         CDS       T01121                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ETAE_0487 (deoA)
Enzymes [BR:etr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ETAE_0487 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
534057..535379
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSEEEIRFFINGIRDNTISEGQIAALAMTIFFHDMAMPERVALT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLESIPGFDIFPDDSRFRSIIADVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTFALSEALAQAIVGVANGAGCRTTALLT
DMNQVLASSAGNALEVREAVQFLTGEARNPRLFEVTMALCVEMLISGKLAADQTEARNKL
QAVLDNGKAAEIFGRMVAAQSGPCDFVERYDHYLPQAVLCKPVFAEQAGIITAMDTRALG
MSVVGLGGGRRQASDSIDYSVGLTEMVRLGDSVDGQRPLAVVHARDEASWQQAAEAVRAA
VTLGERAPEPTPVVYRRITQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctggctcaagaaattatccgcaaaaagcgcgacggccatgcgctgagcgaagaa
gaaattcgctttttcatcaacgggatccgggataacacgatctccgagggacagatcgcc
gcgctggcgatgacgatctttttccacgatatggccatgccggagcgcgtggcgctgacc
atggcgatgcgggactccggcaccgtgctggactggaagtccctgaatctgaacgggccg
attgtcgataagcattcgaccggtggcgtgggggacgtgacctcactgatgctggggccg
atggtcgccgcctgcggtggctatgtgccgatgatctccggtcgcggcctcgggcatacc
ggcggcacgctggataagctagaatcgatcccagggttcgacattttcccggacgacagc
cgtttccgcagcattatcgccgatgtcggcgtcgccattatcgggcagaccagctcgctg
gcgccggcggataagcgtttttatgcgacgcgcgatatcaccgcgacggtcgactctatc
ccgctgatcactgcctctattctggccaagaagctggccgaggggctggatgcgctggtg
atggatgtgaaggttggctccggcgcctttatgccgacgttcgcgctgtctgaggcgctg
gcgcaggcgatcgttggcgtggccaacggcgcaggctgccgcaccacggcgctgctgacc
gacatgaatcaggtgctggcctccagcgccggtaacgcgttggaagtgcgcgaggcggtg
cagttcctgacgggcgaggcgcgcaatccgcgtctgttcgaggtcaccatggcgctgtgc
gttgagatgctgatctccggcaaactggccgcagatcagacggaggcccgcaataagctg
caggcggtactcgacaacggtaaggcggcagagatctttggccgaatggtggcggcgcag
agcggtccgtgtgacttcgttgagcgctatgaccactatttgccacaggcagtgctgtgc
aaaccggtatttgccgaacaagctggtattatcacagcaatggacacccgtgcgctgggg
atgtccgttgtcgggctgggcggcggtcgccgtcaggccagcgatagcattgattacagc
gtagggctaaccgagatggttcgtctgggtgattcggtcgatgggcagcgcccgctggcc
gtggttcatgcccgcgatgaagcgagctggcagcaggccgccgaggcggtgcgcgccgcg
gtgacgctgggagagcgtgcgcctgagccgacgccggtggtgtatcgccgtatcacgcag
taa

DBGET integrated database retrieval system