KEGG   Edwardsiella tarda EIB202: ETAE_0545Help
Entry
ETAE_0545         CDS       T01121                                 

Gene name
gpmB
Definition
(RefSeq) phosphoglycerate mutase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ETAE_0545 (gpmB)
   01230 Biosynthesis of amino acids
    ETAE_0545 (gpmB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAE_0545 (gpmB)
  Energy metabolism
   00680 Methane metabolism
    ETAE_0545 (gpmB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAE_0545 (gpmB)
Enzymes [BR:etr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     ETAE_0545 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
592001..592648
Genome map
AA seq 215 aa AA seqDB search
MRQVYLIRHGETEWNVQRRIQGQSNSPLTVMGEQQARQVGARLGQMGITHVIASDLGRTQ
QTGEIIAAACRCPLTLDARLRELSMGVLESRLLASLSPQEEQWRLSMLDGSPQGCIPQGE
TMAQLAERMQQALNDCLALPQGSRPVLVSHGIALGCLLSTVLGLPPYAERRLRLRNCSLS
RVDYQQSAWLASGWVVETAGDVQHLAQPSMDEVLR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagacaggtatatcttattcgtcacggcgaaacggagtggaacgtacagcggcgtatt
cagggacagtcgaacagcccgctgaccgtgatgggcgaacagcaggcgcggcaggtcggc
gcgcgcttagggcagatgggcattacccacgtgatcgccagcgatctggggcgcactcag
cagacgggggagatcatcgccgcggcctgtcgctgtccgctgacgctggatgcccgtctg
cgcgagctgagcatgggggtgctggagtcgcgtctgttggcctcgctgtcgccgcaggag
gagcagtggcgcctgagcatgctggatggttcgccgcagggctgtattccgcagggggag
accatggcgcagctggctgagcgcatgcagcaggcgctgaacgattgcctggcgctaccg
caggggagccgtccggtgctggtgagccatggcattgccctgggctgcctgctctccacg
gtgctgggactgccgccgtacgctgagcgccgcctgcgcctgcgcaactgctcgctgtcg
cgggtggactatcagcagagcgcatggctggcgagcggatgggtggtcgaaacggcgggg
gatgtacagcatctggcccagccgtcgatggatgaagtgttacgttag

DBGET integrated database retrieval system