KEGG   Edwardsiella tarda EIB202: ETAE_0567Help
Entry
ETAE_0567         CDS       T01121                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ETAE_0567 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAE_0567 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ETAE_0567 (thrC)
Enzymes [BR:etr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ETAE_0567 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
620707..621993
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVNFAQALVQGLGRQQGLFFPHALPALARAQIDALLEQDFVTRSAHILA
AYLGDEFPFETLRDRVQAAFDFPAPVVPVSDDIAALELFHGPTLAFKDFGGRFMAQMLQQ
VAGERPVTILTATSGDTGAAVAHAFYGLKNVQVVILYPRGKVSPLQEKLFCTLGGNIRTL
AIEGDFDACQALVKQAFDDPTLCRELGLNSANSINISRLLAQICYYFEAVAQLPQAARNQ
LVISVPSGNFGDLTAGLLAQSLGLPVKRFIAATNANDTVPRFLSSGVWQPHETVATLSNA
MDVSRPNNWPRVEELFRRREWSLGALGSGALSDAQTAAAMRELAALGYVSEPHAAIAYRA
LRDDLQPGEYGLFLGTAHPAKFQESVEAILQRSIPLPQALAARAALPLLSQTLPADFSRL
RAALLDRP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaatttaaaagatcacaacgagcaggttaactttgcgcaggcgctggtg
caggggctggggcgccagcagggactgttctttccccatgcgctgcccgccctggcgcgg
gcgcagatcgatgccctgctggagcaggattttgtaacccgcagcgcgcatattctggcg
gcgtatctgggggatgagttcccctttgagacgctgcgcgatcgggtgcaggccgccttc
gacttccctgcgccggtggtgccggtcagcgatgatatcgctgcgctggagctgtttcat
gggccgacgctggcattcaaggactttggcgggcgctttatggcgcagatgctgcagcag
gtcgcaggggagcggccggtgaccattctgaccgccacctccggcgataccggcgccgcg
gtcgcccatgcgttttatggtctgaaaaacgtccaggtggtgatcctctacccgcgcggc
aaggtcagtccgctgcaggagaagctgttctgtaccctgggcggcaatattcgtacgctg
gcgatcgagggcgatttcgatgcctgccaggcgctggtcaaacaggcgtttgacgatccg
acgctgtgccgtgagctggggctaaactcggctaactctatcaatatcagccggctgctg
gcgcagatctgctactactttgaggcggtagcccagctgccgcaggcggcgcgcaatcag
ctggtgatctcggtaccgagcggcaacttcggcgatctgaccgccgggctgctggcccag
tcgctggggctgccggtgaagcgttttatcgccgcgaccaatgccaatgataccgtgccg
cgtttcttatccagcggcgtctggcagccccatgagaccgtcgcgaccctctccaatgcc
atggacgtcagccgtcccaacaactggccgcgggtggaagagctgttccggcgtagagag
tggtcgctgggcgcgctgggctccggggcgctgagcgatgcgcagaccgcggcggcgatg
cgtgagctggcggcgctcgggtatgtcagcgaaccccatgctgctatcgcctatcgagcg
ctgcgtgacgatctgcagcccggcgagtatggcctgtttctgggaaccgcccatccggcc
aagttccaagagtctgttgaagcgatcctgcagcggagcatcccgctaccgcaggcgttg
gcggcgcgggctgcactgccgctgctgtcacagacgctgcccgccgacttttcccgcctg
cgggcggcactgctggatcgcccataa

DBGET integrated database retrieval system