KEGG   Edwardsiella tarda EIB202: ETAE_0594Help
Entry
ETAE_0594         CDS       T01121                                 

Gene name
carB
Definition
carbamoylphosphate synthase large subunit
Orthology
K01955  
carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:etr00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:etr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
650756..653977
Genome map
AA seq 1073 aa AA seqDB search
MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVILVNSNPATIMTDPEM
ADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELERQGVLAEFGVTMIGATA
DAIDKAEDRRRFDQAMKKIGLDTARSGIAHSLEESLAVAEQVGFPCIIRPSFTMGGTGGG
IAYNREEFEEICARGLDLSPTNELLIDESLIGWKEYEMEVVRDKNDNCIIVCAIENIDPM
GIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGGSNVQFAVNPKNGRLIVIEM
NPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDITGGRTPASFEPSIDYVVTKIP
RFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKALRGLEVGASGFDPKVNLDDPQA
LTKIRRELKDAGAERIWYVADAFRAGLSVDGVFNLTNIDRWFLVQIEELVRLEERVADVG
INGLTPDFLRQLKRKGFADARLARLAGVAESEIRKLRHKQGLHPVYKRVDTCAAEFATDT
AYLYSTYEEECEANPTHDRPKIMVLGGGPNRIGQGIEFDYCCVHASLALREDGYETIMVN
CNPETVSTDYDTSDRLYFEPVTLEDVLEIVAVERPQGVIVQYGGQTPLKLARALEAAGVP
VIGTSPDAIDRAEDRERFQQAVNRLGLKQPANATVTAIEQAVEKGAQIGYPLVVRPSYVL
GGRAMEIVYDESDLRRYFQTAVSVSNDAPVLLDHFLDDAVEVDVDAICDGERVLIGGIME
HIEQAGVHSGDSACSLPAYTLSAEIQDELRRQAEKLAMELCVRGLMNVQFAVKDNQVYLI
EVNPRAARTVPFVSKATGVPLAKVAARVMVGQTLAQQGMTEEVIPPYYSVKEVVLPFAKF
PGVDPILGPEMRSTGEVMGVGRTFAEAFAKAMLGSQSQVKTPGRALLSVREGDKHRVVDL
AAKLLKQGFELDATHGTAVVLGEAGINPRLVNKVHEGRPHIQDRIKNGEYTYIVNTTAGR
QAIEDSKLIRRSALRYKVHYDTTLNGGFATAMALNADPTEQVISVQEMHARLK
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacgtactgatattaaaagcatcctgatcctgggcgccgggccgatcgtcatc
ggccaggcgtgcgagttcgactactccggcgctcaggcctgtaaggcactgcgcgaagag
ggctaccgcgtcatcctggttaactccaacccggccactattatgaccgacccggagatg
gccgacgcgacctatattgagccgattcactgggaagtcgtgcggaagatcatcgaaaaa
gagcgtcccgatgcggtgctgccgacgatgggtggccagacggcgctgaactgtgccctg
gagctggagcgccagggggtgttggccgagtttggcgtgaccatgatcggcgcgacggcc
gacgccatcgataaggctgaggatcgtcgacgcttcgaccaggcgatgaagaagatcggc
ctggataccgcgcgctctggcatcgctcacagtctggaagagtcgctggcggtggcggag
caggtcggtttcccctgcattatccgcccgtcgtttacgatgggtggcaccggcggcggt
atcgcgtacaaccgcgaagagtttgaagagatctgcgcgcgcggtctggatctttcaccg
accaatgagctgctgatcgatgagtcgctgatcggctggaaagagtatgagatggaggtg
gtgcgcgataagaacgacaactgcattatcgtctgcgctatcgaaaacattgatccgatg
gggatccacaccggtgattcgattaccgtcgcgccggcgcagaccctgaccgataaagag
tatcaaatcatgcgtaacgcctcgatggcggtactgcgtgagataggcgtggagaccggt
ggctccaacgtacagtttgcggttaacccgaaaaacggccgtctgatcgttatcgagatg
aacccgcgcgtatcgcgttcttctgcgctggcctctaaggcgaccggtttcccgatcgcc
aaagtcgcggccaagctggcggtgggctacaccctggacgagctgatgaacgacatcacc
ggggggcgtacgccggcgtcgtttgagccctctatcgactacgtggtgaccaagatcccg
cgcttcaactttgaaaagtttgccggtgctaacgatcgcctgaccacgcagatgaagtcg
gtgggtgaggtgatggcgattggccgtacccagcaggagtcgctgcagaaggcgctgcgc
gggctggaggtcggcgcgagcggcttcgatcctaaggtgaacttagacgatccgcaggcg
ttgaccaagatccgtcgcgagctgaaagatgccggcgccgagcgtatctggtatgtcgcg
gatgccttccgcgccggcctgtcggtggatggggtatttaacctgaccaacatcgatcgc
tggttcctggtgcagatcgaggagctggtgcgcctggaggagcgggttgccgacgtgggc
atcaatggcctgacgccggatttcctgcgtcagctgaagcgtaaagggtttgccgatgca
cgcctggcccgtctggccggcgtggcagagagcgagattcgcaagctgcgccataagcag
gggctgcatccggtgtataagcgcgtggacacctgcgcggctgaattcgcgaccgacacg
gcctacctttactccacctatgaagaggagtgcgaggctaacccgacgcacgatcgcccg
aagatcatggtgctgggcggtggcccgaaccgtatcggccaggggattgagtttgactac
tgctgcgtgcatgcgtcgctggcgctgcgtgaggatggctatgaaaccatcatggtcaac
tgtaaccccgaaacggtctctacggattatgatacctctgaccgcctctactttgagccg
gtcacgctggaggatgtgctggagatcgtcgccgtcgagcgcccgcagggggtgatcgta
cagtacggcggccagacgccgctgaagctggcccgggcattagaggccgccggcgtgccg
gttatcggcaccagcccggacgcgattgaccgcgccgaggatcgcgagcgcttccagcag
gcggtgaatcgcctggggctgaagcagccggccaacgccaccgtcacggccattgagcag
gcggtggagaagggggctcagataggctatccgctggtggtgcgcccctcttatgtcctc
ggcggtcgagcgatggagatcgtctacgacgagagcgatctgcggcgctacttccagacg
gcggtcagcgtctccaacgatgcgccggtgctgctggatcacttcctggacgatgcggtc
gaagtggacgtcgatgccatctgtgacggtgagcgcgtgctgatcggcggcattatggag
cacattgagcaggcgggggtgcactccggtgactccgcctgttcgctgccggcctacacc
ctgagtgcggagatccaggacgagctgcgccgccaggcggagaagctggcgatggagctg
tgcgtgcggggtctgatgaacgtgcagtttgccgtcaaagataaccaggtgtacctaatt
gaggtcaacccacgcgccgcccgtaccgtgcccttcgtctccaaggcgaccggcgtcccc
ttggccaaggtggccgcccgggtgatggtggggcagacgctggcgcagcagggaatgacg
gaagaggtgatcccgccctattactccgtcaaagaggtggtgctgccgtttgccaagttc
cccggcgtcgacccgattctggggccggagatgcgctctaccggtgaggtgatgggcgtg
ggccggacctttgccgaggcctttgccaaggcgatgctcggcagtcagtcacaggtgaag
accccgggccgcgccctgctgtcagtccgcgagggcgataagcaccgggtggtggatctg
gcggccaagctgctcaagcagggctttgagctggatgcgacccacggcaccgcggtggtg
ctgggggaggccggtatcaacccgcgtctggtcaacaaagtgcatgaggggcgcccgcac
attcaggatcgcatcaagaatggcgagtacacctatattgtgaacaccaccgccgggcgt
caggcgatcgaggactctaagctgatccgtcgcagcgcgctgcgctacaaggtgcactat
gacaccaccttgaacggcggctttgctacggcgatggcgctgaacgcggatccgaccgag
caggtgatttcggtacaggagatgcatgcccgcctgaagtaa

DBGET integrated database retrieval system