KEGG   Edwardsiella tarda EIB202: ETAE_0712Help
Entry
ETAE_0712         CDS       T01121                                 

Gene name
recD
Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:etr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ETAE_0712 (recD)
Enzymes [BR:etr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ETAE_0712 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
788343..790196
Genome map
AA seq 617 aa AA seqDB search
MRESLLSQMAQQRTLRPLDLQFATLLAGPQQPHLALAAALVSQELAAGHVCLPLTALDTA
TLSQRFPQQADAWPALLAGWDVARWRDYLLAQPCVSGGDRATPLVVSHDCLYLQRLWRDE
GTVAAFFAAACAQPRRVDGALAPVLHRLFPATAQRPDWQQVAAAVAVTRRASVISGGPGT
GKTTTVARLLAALVALAPGRMPRIQLAAPTGKAAARLGESLGQALAALALAPDQLQAMPR
EALTLHRLLGARADSARLRYHRDNPLHLDVLVVDEASMVDLPMMARLIEALPPQAQLILL
GDRDQLASVEAGAVLGELCRFAEYGFSAARAAELSQLCDAPIPAGETQPAVALRDAISLL
RHSYRFDARSGIGQLALAVNRGDRRMAMACLADRFADLHWHEIAQDEDYQTLLTCCLAGY
RPMLEGILRGEAPAQILAKFARFRPLCALREGPFGLHGLNERIALTLQRAGLIRRAHEGQ
KHWYAGRPVMITRNDASQALFNGDIGITLGDEQSGWQVWFMGSDGAPRAVQPNRLPPHET
AWAMTVHKSQGSEFDHTLLALPTQPSPVVTRELVYTAITRARQQLTLFATQPVLERAIRT
PTERRSGLMARLLAAAD
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtctctactctcccagatggcgcagcagcgtacgctgcgcccgctggatctg
cagtttgccacgctgttagccgggccgcagcagccgcacctggcgctggccgcggcgctg
gtcagccaagagctggccgccgggcatgtctgcctgccgctgacggcgctggatacggcg
acgctgagccagcgctttccgcagcaggccgatgcgtggccagcgctgctcgccgggtgg
gacgttgctcgctggcgggactacctgctggcgcagccctgcgtcagcggtggcgatagg
gcgacgccgctggtggtcagccacgattgcctgtatctacagcgactatggcgtgatgag
ggcacggtggcggcctttttcgccgcggcctgtgcgcagccgcggcgcgtcgatggcgcg
ctggcgccggtgctgcaccgtctgttcccagccacggcccagcggccggactggcagcag
gtggccgcggccgtggcggtgacgcgccgggcgtcggtgatctccggcgggcccggcacc
ggtaaaaccacgaccgtagcgcgcctgctggcggcgttggtcgcgctggcgcccggtcgg
atgccgcgtattcagttggcggcgccgacgggcaaggcggcggcgcgtctgggtgagtcg
ctggggcaggccttggcggcattggcgctggcgccggatcagctgcaggcgatgccgcgc
gaagcgctgacgctgcatcggctgctgggtgcccgggcagacagcgcccgcttgcgctat
caccgggataatccgctgcatctggatgtgctggtggtggatgaggcttcaatggtggat
ctgccgatgatggcgcggctgatcgaggcgttgccgccgcaggcgcagctgatcctgctg
ggggatcgcgatcagctggcgtcggtggaggccggcgcggtgctgggtgagctgtgccgc
tttgccgaatatggcttcagcgccgcgcgcgcggccgagctgagccagctgtgcgatgcg
ccgatccccgccggagagacgcagccagcggtcgccctgcgtgacgccatcagcctgctg
cgtcacagctaccgcttcgacgcccgttcagggatcgggcagctggcgctggccgtcaat
cggggcgatcgccggatggctatggcgtgtctggcggaccgctttgccgatctgcattgg
cacgaaatcgctcaggatgaagactaccagacgctcttaacgtgctgtctggcggggtat
cgcccgatgctggaggggatcctgcgcggggaggccccggcgcagatcctggccaaattt
gcccgcttccgtccgctgtgcgccctgcgcgaggggccctttggcctacatggtctcaac
gagcgtatcgctctgacgctgcagcgggcggggctgatccggcgcgcgcatgaggggcaa
aagcactggtatgccgggcgtccggtgatgatcacccgcaacgacgccagtcaggcgctg
tttaacggcgatatcggtattacgctgggcgatgaacagagcggctggcaggtgtggttt
atgggcagcgacggcgcgccgcgcgcggtacagcccaaccgtctaccgccccatgagacg
gcctgggcgatgacggtgcacaagtcgcagggatcggagttcgaccatacgctgctggcg
ctgccgacccaaccgtcgccggtggtgacgcgtgagctggtgtataccgccatcacgcgg
gcgcgccagcagctgacgctctttgcgacccagccggtgctggagcgggccatccgtacg
ccgaccgaacggcgcagcgggctgatggcccgtctgctggccgccgccgattaa

DBGET integrated database retrieval system