KEGG   Edwardsiella tarda EIB202: ETAE_0741Help
Entry
ETAE_0741         CDS       T01121                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00900  Terpenoid backbone biosynthesis
etr01100  Metabolic pathways
etr01110  Biosynthesis of secondary metabolites
etr01130  Biosynthesis of antibiotics
Module
etr_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ETAE_0741 (dxr)
Enzymes [BR:etr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     ETAE_0741 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ACY83586
UniProt: D0ZCV5
Position
817796..818995
Genome map
AA seq 399 aa AA seqDB search
MKTLTILGSTGSIGTSTLAVVRANPGAFRVVALVAGKNVDVMLQQCREFSPRYVCMADEG
AAAALRQRLFECGLGAIAVMSGEHAACELAALDEVDQVMAAIVGAAGLLPTLAAIRANKR
VLLANKEALVTCGRLFMEALSHSQAQLLPIDSEHNAIFQSLPTAVQQQLGFASLREHGVT
RIVLTGSGGPLRQLPLADFDAVTPAQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLF
NASAEEMEVIVHPQSVIHSMVRYRDGSVIAQLGNPDMCTPIAHAMAYPDRAPSGVAPLDF
CRMGSLSFEAPDMARYPCLQLAIEAFAEGQAATTALNAANEIAVAAFLDGRLRFTDIARL
NRGVVEQLRCAEPDCVEAVLAIDCAARQAAQTLSARFSR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgctgaccattttaggttcaaccggctccatcggcaccagtacgctggcggtg
gtgcgggccaatcccggcgcgttccgcgtggtagcactggtggcaggcaagaacgttgat
gtcatgctgcagcagtgccgtgaattttccccccgctatgtctgtatggccgatgaaggt
gccgccgccgcgctgcgccagcgcctgttcgagtgcggccttggcgcgattgccgtgatg
agcggcgagcacgccgcctgcgagctcgccgccctggatgaggtcgaccaggtgatggcg
gcgatcgtcggcgccgcgggcctgctgccgacgctggcggcgattcgggctaacaagcgg
gtgctgctggccaacaaagaggccctagtgacctgtggacgtctgtttatggaggcgctc
tcccacagccaggcgcagctgctgcctatcgacagtgaacacaacgccatttttcagagc
ctgccgacggcggtacagcagcagctgggctttgccagcctgcgtgagcacggggtgacc
cgtatcgtactgaccggctccggcgggccgctgcgtcagctgccgttggcggattttgat
gctgtcacgccggcgcaggcctgcgcgcatcccaactggtctatggggcgtaagatctcc
gtcgactccgccaccatgatgaataaagggctggagtatattgaggcgcgctggctgttc
aatgcctcggcggaggagatggaggtgatcgttcacccgcagtcggtgatccactccatg
gtgcgctaccgggacggcagcgtgattgcccagctgggtaatcctgacatgtgtacgccg
atcgcccacgccatggcctatcccgaccgcgcgccgagcggcgttgcgccgctggatttc
tgccgaatgggctcgctgagctttgaggcgccggatatggcgcgctacccctgtctgcag
ctggctatcgaggcgtttgccgaggggcaggcggcgacgacggcgctgaatgcggcgaat
gaaattgcggttgccgcctttctcgatgggcgtctacgctttactgacatcgcccggctg
aaccgcggcgtggtggagcagctgcgctgcgctgagccggactgcgttgaggcggtgctg
gcgattgattgcgccgctcgccaggcggcccagacgctgagcgcgcgtttttcccgctaa

DBGET integrated database retrieval system