KEGG   Edwardsiella tarda EIB202: ETAE_1022Help
Entry
ETAE_1022         CDS       T01121                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
etr  Edwardsiella tarda EIB202
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:etr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ETAE_1022 (recR)
DNA repair and recombination proteins [BR:etr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ETAE_1022 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1113304..1113909
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFHLLQRDRSGGMRLAQALTRAMSEIGHCRDC
RTFTEQEVCTICTNARRRENGQICVVESPADIHAIEQTGQYSGRYFVLMGHLSPLDGIGP
QDIGLDRLEARLGQETLSEVILATNPTVEGEATANYIAEMCAAHGVLASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHPVTR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccagcccgcttcttgaatccctgatggaggcgctgcgctgtttgcccggcgtc
ggccccaagtcggcccagcgcatggcgtttcacctgctgcagcgcgatcgcagcggggga
atgcgcctggcgcaggcgctgacgcgcgcgatgtcggagatcggccactgtcgagactgt
cgcaccttcaccgagcaggaggtctgtactatctgcaccaacgcgcgtcggcgtgagaat
gggcagatctgcgtggtggagagcccggcggatattcatgccattgagcagactggacag
tactccgggcgctatttcgtgctgatggggcacctctctccgctggacggcataggtcca
caggatattggtctggacaggctggaggcgcggctgggccaagagacgctcagcgaagtg
atcctcgccaccaacccgacggtcgagggcgaggcgaccgccaactacatcgcggagatg
tgtgcggcgcacggcgtgctggccagccgtatcgcccacggcgtgccggtggggggcgag
ctggagatggtcgatggcaccaccctgtctcactcgttggccgggcgtcacccggtgacg
cgctga

DBGET integrated database retrieval system