KEGG   Edwardsiella tarda EIB202: ETAE_1144Help
Entry
ETAE_1144         CDS       T01121                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ETAE_1144 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAE_1144 (glk)
   00052 Galactose metabolism
    ETAE_1144 (glk)
   00500 Starch and sucrose metabolism
    ETAE_1144 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ETAE_1144 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ETAE_1144 (glk)
   00524 Butirosin and neomycin biosynthesis
    ETAE_1144 (glk)
Enzymes [BR:etr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ETAE_1144 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1245208..1246173
Genome map
AA seq 321 aa AA seqDB search
MSRFALVGDVGGTNARLALCCLDTGCLQAVQSYPGQQFDSLESVIRTYLQAQAVSVTSAC
IAIACPITGDRVAMTNHSWAFSISAMQRSLGLAHLSVINDFTAVSMAVPVLPAESLLQLG
GQTAQPDRPIAIYGAGTGLGVAHLIRAGDRWISLPGEGGHVDFATGSDEEDALLTALRAD
LGRVSAERVLSGPGLVNLYRAVARVAGRTPQSLTPQEVSERALADRCPDCRRALSLFCVM
MGRFGGNLALNMGTFGGVYIAGGIVPRFLAFFRDSGFRQAFEDKGRFKAYLAPIPVFLIV
HDNPGLLGAGAYLRQQLGTRL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgcgttggttggcgatgtgggcgggaccaatgcccgcctggcgctgtgc
tgtctcgacaccgggtgtctccaggcggtgcagagctacccgggacagcagttcgatagc
ctggagtcggtcatccggacttacctgcaggcgcaggcggtatcggtgacgtcggcctgt
atcgcgatcgcctgcccgatcaccggcgatcgcgtggcgatgaccaatcacagctgggcg
ttttccatcagcgcgatgcagcgttcgctggggttggcgcacctgtcggtgatcaacgac
tttaccgcggtctccatggcggtgccggtgctccccgcggagagtctgctgcagctgggc
ggccagacggcgcagcccgatcggcctatcgccatctacggcgccggtaccgggctgggc
gtcgcgcacctgatccgggccggagatcgctggatcagcctgccgggtgaggggggacat
gtggatttcgcgaccggtagcgatgaagaggacgcgctgctgacggcgctgcgcgccgac
ctggggcgggtctccgccgagcgggtgctctccggccccggtctcgtcaatttgtatcgc
gccgtcgcccgggttgcggggcggacgccgcagtccctgacgccgcaggaggtcagcgag
cgggcgctggccgatcgctgtccggactgtcgacgggcgctgtcgctgttctgtgtgatg
atggggcgctttggtggcaatctggcgctgaatatgggcacctttggcggggtgtatatc
gccggcgggatcgtgccgcgttttctggcgtttttccgcgactccggctttcgtcaggcg
ttcgaggacaaggggcgctttaaggcgtatctcgcgccgatcccggtctttctgatcgtg
cacgacaatcccggtctgcttggcgccggcgcctatctgcgtcagcagctgggcactcgt
ctttaa

DBGET integrated database retrieval system