KEGG   Edwardsiella tarda EIB202: ETAE_1155Help
Entry
ETAE_1155         CDS       T01121                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ETAE_1155 (folE)
Enzymes [BR:etr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ETAE_1155 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1256676..1257338
Genome map
AA seq 220 aa AA seqDB search
MSSLSKEAALVHEALLARGLETPLRGEPLARDTRKAQIEAHMTEVMRLLNLDLSDDSLAE
TPSRIAKMYVDEIFSGLDYANFPKITIIENKMHVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKEGVIGLSKINRIVRFFAQRPQVQERLTQQILVALQTLLGTKNVAVSIDAVHYC
VKARGVRDATSATTTTSLGGLFKTSQNTRQEFLRAVRHHV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgctaagtaaagaagctgcactggtgcacgaggcgctgctggcgcgtgggctg
gaaaccccgctgcgcggtgagccgctggcgcgcgatacgcgtaaggcacagattgaggcg
cacatgaccgaagtcatgagactgttgaatctggatctgtcggatgacagcctggcggag
acgccgtcgcggatcgccaaaatgtacgtggacgaaattttttccggactggattacgct
aacttccctaaaatcaccattattgaaaataaaatgcatgtcgatgagatggtgacggtg
cgcgatattacgctgaccagcacctgcgaacaccatttcgtcaccatcgacggtaaggcg
acggtcgcctatatcccgaaagagggggtaattgggctgtccaagatcaaccggattgtc
cgctttttcgcccagcgtccgcaggtgcaggagcgtttgacccagcaaattctggtggcg
ctgcagacgctgttggggaccaagaacgtcgccgtctccatcgatgcggtgcactactgc
gtcaaggcccgcggcgtacgcgatgcgaccagcgcgaccaccaccacctcgcttggcggg
ctgtttaaaaccagtcaaaatacccggcaggagtttctgcgcgcggtgcgccaccacgtc
tag

DBGET integrated database retrieval system