KEGG   Edwardsiella tarda EIB202: ETAE_1155Help
Entry
ETAE_1155         CDS       T01121                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00790  Folate biosynthesis
etr01100  Metabolic pathways
Module
etr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ETAE_1155 (folE)
Enzymes [BR:etr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ETAE_1155 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACY84000
UniProt: D0ZFG8
Position
1256676..1257338
Genome map
AA seq 220 aa AA seqDB search
MSSLSKEAALVHEALLARGLETPLRGEPLARDTRKAQIEAHMTEVMRLLNLDLSDDSLAE
TPSRIAKMYVDEIFSGLDYANFPKITIIENKMHVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKEGVIGLSKINRIVRFFAQRPQVQERLTQQILVALQTLLGTKNVAVSIDAVHYC
VKARGVRDATSATTTTSLGGLFKTSQNTRQEFLRAVRHHV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgctaagtaaagaagctgcactggtgcacgaggcgctgctggcgcgtgggctg
gaaaccccgctgcgcggtgagccgctggcgcgcgatacgcgtaaggcacagattgaggcg
cacatgaccgaagtcatgagactgttgaatctggatctgtcggatgacagcctggcggag
acgccgtcgcggatcgccaaaatgtacgtggacgaaattttttccggactggattacgct
aacttccctaaaatcaccattattgaaaataaaatgcatgtcgatgagatggtgacggtg
cgcgatattacgctgaccagcacctgcgaacaccatttcgtcaccatcgacggtaaggcg
acggtcgcctatatcccgaaagagggggtaattgggctgtccaagatcaaccggattgtc
cgctttttcgcccagcgtccgcaggtgcaggagcgtttgacccagcaaattctggtggcg
ctgcagacgctgttggggaccaagaacgtcgccgtctccatcgatgcggtgcactactgc
gtcaaggcccgcggcgtacgcgatgcgaccagcgcgaccaccaccacctcgcttggcggg
ctgtttaaaaccagtcaaaatacccggcaggagtttctgcgcgcggtgcgccaccacgtc
tag

DBGET integrated database retrieval system