KEGG   Edwardsiella tarda EIB202: ETAE_1200Help
Entry
ETAE_1200         CDS       T01121                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ETAE_1200 (galF)
   00052 Galactose metabolism
    ETAE_1200 (galF)
   00500 Starch and sucrose metabolism
    ETAE_1200 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    ETAE_1200 (galF)
Enzymes [BR:etr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ETAE_1200 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1304645..1305547
Genome map
AA seq 300 aa AA seqDB search
MTSLKAVIPVAGLGMKMLPATKAIPKEMLPIVDKPLIQKVVHECVQAGVKEIILVTHSSK
NAIENHFDTSFELEALLEARVKRQLLDEVRSICPPGVTINSVRQHKPLGLGHAILCARPL
VGEHPFIVALPDIWLDTSTFDPASQNLAAMVKRFEESGRSQVLVQPMPLEVLPEYSVINC
ADAVLEPGQSARMTSIVEKPEDAEKYQSDLSAVGRYVLSAAIWPILAATGFGAWERIQLS
DAIATLLQHRPVEAYRQVGRSYDCGEKLGYAEAFVAGGLSHSQQGEAFTTWLRDLQTRID
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacttaaagccgttatccctgtcgccggactggggatgaagatgttgccagcg
actaaggccatcccgaaagagatgctgcccatcgtcgataagccgttgattcaaaaagta
gtacacgaatgtgttcaggcgggggtgaaagagatcatcctggtgacccactcctctaag
aatgccatcgagaaccacttcgacacctccttcgagttggaggcgctgcttgaggcgcgc
gtcaagcgtcagctgttggatgaggtgcgttccatctgtccgccgggggtgactattaac
agcgtgcgtcagcataagccgctggggctggggcatgccatcctctgcgcccgtcctctg
gtcggggagcatccctttattgtcgcgctgccggatatctggctagacaccagcaccttc
gatcccgctagccagaacctggcggcgatggtcaagcgcttcgaagagagtggccgcagt
caggtcttggtgcagccgatgccgctagaagtgctgccggagtactcggtgatcaactgt
gccgatgcggtgttggagccggggcagagcgcccgtatgacctcgattgtagaaaaaccc
gaggacgccgagaaataccagtctgacctgtccgcggtcgggcgctatgttttgtctgct
gctatctggccgatcttggccgccaccggctttggcgcctgggagcgcatccagctctcc
gatgctatcgcaaccctgctgcagcaccgtccggttgaggcctatcgccaggtcgggcgg
tcctatgactgcggtgagaaattggggtatgctgaagcctttgtcgccggtgggttgagt
cactctcagcagggagaggcctttaccacctggctgcgggatttgcagacgcgaattgat
tga

DBGET integrated database retrieval system