KEGG   Edwardsiella tarda EIB202: ETAE_1291Help
Entry
ETAE_1291         CDS       T01121                                 

Definition
UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase
Orthology
K07806  
UDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC:2.6.1.87]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Two-component system
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ETAE_1291
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ETAE_1291
Enzymes [BR:etr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.87  UDP-4-amino-4-deoxy-L-arabinose aminotransferase
     ETAE_1291
Lipopolysaccharide biosynthesis proteins [BR:etr01005]
 Unusual sugar
  ETAE_1291
Amino acid related enzymes [BR:etr01007]
 Aminotransferase (transaminase)
  Others
   ETAE_1291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1400800..1401945
Genome map
AA seq 381 aa AA seqDB search
MKDFLPFSKPAIGEEEIAAVSEVLRSGWITTGPQNQALEQEFCQAIGARHAIAVCSATAG
MHVTLMALGIGPGDEVITPSMTWVSTLNIITLLGATPVMIDVDRDTLMVTPEAIAEAITP
RTKAIIPVHFAGAPVDLDPIRALAQRHGIALIEDAAHAIGTAYRGEPIGQRGTAIFSFHA
IKNVTCAEGGMVVTDDDALAQKVRSLKFHGLGVDAYDRQTHGRAPQAEVVTPGYKYNLAD
INAAIARVQLAKLPELNAQRARLAAYYLQQLALHQLPFTPLSAPDWPHQHAWHLFIIRCD
EARCGVDRDRLMQALKERNIGSGLHFRAAHTQKYYRETYPQLRLAQTEWNSQRICSLPLF
PDMTEADVDRVIGALKEIIEQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaggactttttgccattctccaagccagctatcggcgaggaggagattgctgcagtc
agtgaagtgctgcgctccggctggatcacgaccggtccgcaaaatcaggcgttggagcaa
gagttctgccaggctatcggcgcccgtcatgctatcgccgtgtgctccgcgacggcggga
atgcacgttaccctgatggcgctgggcattgggccgggggatgaagtgataaccccgtca
atgacctgggtgtccaccctgaatatcatcacgctgctgggggcgacccccgtgatgatc
gatgtcgatcgcgatacgctgatggtgacgccagaggctattgccgaggcgataacgccg
cgcaccaaggcgattattcccgtccatttcgccggcgcccccgtcgatcttgacccgatc
cgcgcgctggcgcagcggcacggcattgccctgatcgaagacgcggcccatgccattggc
accgcctaccgcggtgagcctatcggccaacgcggcaccgccattttctcgtttcatgcg
atcaaaaacgtcacctgtgccgagggcggcatggtggtgaccgatgatgatgctctggcg
cagaaggtgcgcagcctgaagtttcacggtctgggcgtggatgcctacgatcgccagacc
catggccgggcgccgcaggcagaggtggtgacgccgggatacaagtacaacttggccgac
atcaacgcggcgatagcccgggtgcagctggcaaaactgcctgagctcaacgcccagcgc
gcccggctggcggcctattacctgcagcagttggcgctgcatcagctgccgttcactccg
ctgagcgcgcccgactggccgcatcagcatgcttggcacctgtttatcatccgttgcgat
gaggcccgctgcggcgtggatcgcgatcggctgatgcaggcgctcaaagagcgcaacatc
ggcagcgggctgcactttcgcgccgcccacacgcaaaaatattaccgtgagacctatcca
cagctacgtctggcgcagacggagtggaattcacagcgtatctgctccctgccgctgttt
ccggatatgaccgaggcagacgtagatcgggtgatcggcgcgttgaaagagattattgag
cagtaa

DBGET integrated database retrieval system