KEGG   Edwardsiella tarda EIB202: ETAE_1291Help
Entry
ETAE_1291         CDS       T01121                                 

Definition
UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase
Orthology
K07806  
UDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC:2.6.1.87]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Two-component system
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:etr00520]
Environmental Information Processing; Signal transduction; Two-component system [PATH:etr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1400800..1401945
Genome map
AA seq 381 aa AA seqDB search
MKDFLPFSKPAIGEEEIAAVSEVLRSGWITTGPQNQALEQEFCQAIGARHAIAVCSATAG
MHVTLMALGIGPGDEVITPSMTWVSTLNIITLLGATPVMIDVDRDTLMVTPEAIAEAITP
RTKAIIPVHFAGAPVDLDPIRALAQRHGIALIEDAAHAIGTAYRGEPIGQRGTAIFSFHA
IKNVTCAEGGMVVTDDDALAQKVRSLKFHGLGVDAYDRQTHGRAPQAEVVTPGYKYNLAD
INAAIARVQLAKLPELNAQRARLAAYYLQQLALHQLPFTPLSAPDWPHQHAWHLFIIRCD
EARCGVDRDRLMQALKERNIGSGLHFRAAHTQKYYRETYPQLRLAQTEWNSQRICSLPLF
PDMTEADVDRVIGALKEIIEQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaggactttttgccattctccaagccagctatcggcgaggaggagattgctgcagtc
agtgaagtgctgcgctccggctggatcacgaccggtccgcaaaatcaggcgttggagcaa
gagttctgccaggctatcggcgcccgtcatgctatcgccgtgtgctccgcgacggcggga
atgcacgttaccctgatggcgctgggcattgggccgggggatgaagtgataaccccgtca
atgacctgggtgtccaccctgaatatcatcacgctgctgggggcgacccccgtgatgatc
gatgtcgatcgcgatacgctgatggtgacgccagaggctattgccgaggcgataacgccg
cgcaccaaggcgattattcccgtccatttcgccggcgcccccgtcgatcttgacccgatc
cgcgcgctggcgcagcggcacggcattgccctgatcgaagacgcggcccatgccattggc
accgcctaccgcggtgagcctatcggccaacgcggcaccgccattttctcgtttcatgcg
atcaaaaacgtcacctgtgccgagggcggcatggtggtgaccgatgatgatgctctggcg
cagaaggtgcgcagcctgaagtttcacggtctgggcgtggatgcctacgatcgccagacc
catggccgggcgccgcaggcagaggtggtgacgccgggatacaagtacaacttggccgac
atcaacgcggcgatagcccgggtgcagctggcaaaactgcctgagctcaacgcccagcgc
gcccggctggcggcctattacctgcagcagttggcgctgcatcagctgccgttcactccg
ctgagcgcgcccgactggccgcatcagcatgcttggcacctgtttatcatccgttgcgat
gaggcccgctgcggcgtggatcgcgatcggctgatgcaggcgctcaaagagcgcaacatc
ggcagcgggctgcactttcgcgccgcccacacgcaaaaatattaccgtgagacctatcca
cagctacgtctggcgcagacggagtggaattcacagcgtatctgctccctgccgctgttt
ccggatatgaccgaggcagacgtagatcgggtgatcggcgcgttgaaagagattattgag
cagtaa

DBGET integrated database retrieval system