KEGG   Edwardsiella tarda EIB202: ETAE_1439Help
Entry
ETAE_1439         CDS       T01121                                 

Gene name
ruvA
Definition
holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:etr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1550776..1551384
Genome map
AA seq 202 aa AA seqDB search
MIGRLRGTILEKQPPQVVLETHGVGYEVQMPMTCFYELPQVGSEAVIFTHFVVREDAQLL
YGFNNKQERALFRELIKVNGVGPKLALAILSGMSAQQFVAAVEREEVAALVKLPGVGKKT
AERLVVEMKDRFKGLSGDLFTPTDDLPPSTQPQAQADAEGEAVAALIALGYKPQEASRLV
NRVTVAGADSETLIRDALRAAL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgattggtcgcctcagaggaactattctggaaaagcagccgccgcaggtggtgctggaa
acccacggcgtcggctatgaggtgcagatgccgatgacctgcttttatgagctgccgcag
gttggcagtgaagcggtgatctttacccacttcgtggtacgcgaagacgcccagctgctg
tacgggttcaacaataagcaggagcgcgcgctgttccgcgaactgatcaaggtcaacggc
gtcgggcccaagctggcgctggcgatcctgtccgggatgtcggcgcagcagtttgtcgcg
gcggttgagcgtgaagaggtcgcggcgctggtcaagctgccgggcgtgggcaagaaaacc
gccgagcggctggtggtcgagatgaaggaccgcttcaaggggctgagcggcgatctgttt
accccgacggatgacctgccgccgagcacccaaccgcaggcccaggcggatgccgagggc
gaggcggttgccgcgctgatcgcgctgggctacaagccacaggaggccagccgcctggtg
aaccgggtgacggtggccggcgctgacagtgaaaccctgatccgcgacgcgctgcgcgcg
gcgctgtaa

DBGET integrated database retrieval system