KEGG   Edwardsiella tarda EIB202: ETAE_1486Help
Entry
ETAE_1486         CDS       T01121                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ETAE_1486 (pncA)
Enzymes [BR:etr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     ETAE_1486 (pncA)
    3.5.1.-  
     ETAE_1486 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1599285..1599920)
Genome map
AA seq 211 aa AA seqDB search
MSAALLLIDLQNDFCPQGALAVPQGDEVIPVALQAVAMARRDGIPVIATQDWHPAEHGSF
ASRSGGQLGEVGELNGLPQVWWPDHCVQNTIGAAFHPALRDTAFDFVVHKGTDAAVDSYS
AFFDNGRRCATALDAWLRQHGITRLWLLGLATDYCVKFSVLDALRLGYQVNIIRDGCRGV
DLTPGDSERALAEMVRAGASLTPLTTLSHLR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgcacttttgctgatcgatctacagaatgatttttgccctcagggcgcgctg
gcggttccccagggcgatgaggtcatccccgtcgccctgcaggcggtcgccatggcgcgt
cgggacggcatcccggtgatcgcgacccaggattggcatccggcggagcacggcagcttc
gccagccgcagcggcgggcagctgggcgaggtcggcgagctcaatggcctgccccaggtc
tggtggcctgaccactgcgtgcaaaacaccatcggcgccgcgtttcacccggccctgcgc
gataccgccttcgattttgtggtgcataagggaactgacgccgcagtggatagctacagc
gcctttttcgacaacggtcggcgctgcgccaccgcgctggatgcctggctgcgccagcac
ggcatcacccgcctgtggctgctgggtctggcgacggattactgcgtgaagttttcggtg
ctggacgccctgcgcctgggctatcaggtcaatatcattcgcgacggctgccgcggcgtg
gatctcacgcccggcgatagcgaacgcgcgctggccgaaatggtccgcgccggggctagc
ctaaccccgctcaccacgctcagccacctgcgctga

DBGET integrated database retrieval system