KEGG   Edwardsiella tarda EIB202: ETAE_1503Help
Entry
ETAE_1503         CDS       T01121                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:etr00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:etr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:etr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:etr00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1613914..1614825
Genome map
AA seq 303 aa AA seqDB search
MSTSVRKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILV
THSSKNSIENHFDTSFELEAILEKRVKRQLLAEVQAICPKHVTIMQVRQGLAKGLGHAIL
CAHPLVGDEPFAVILPDVILDEYSADLSSDNLSEMLRRYESTGASQIMVEPVPMADVSNY
GVVDCSGAQLAAGESIAIRAVVEKPPRDKAPSNLSIVGRYVLSPDIWPLLSKTPPGAGEE
IQLTDAIAMLLKNETVEAYHLKGRSHDCGNKLGYMQAFVEYGLRHPALGKDFAAWIKGLN
LSK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgtcagtgagaaaagtaaaaaaagccgttatcccggtggccggattgggaacg
cgtatgctgccagcaacgaaagctattcctaaagaaatgttgccgctggtagataaaccg
ctgatccagtacgtggttaatgagtgtattgccgccggtattaatgagatcattttagtc
acgcattcatcgaagaactccatcgagaaccacttcgataccagctttgagctggaggcg
atccttgagaagcgcgttaagcgtcagctgctggccgaagtccaggccatttgtcctaag
cacgtgaccattatgcaggtgcgtcagggactggctaaaggtttaggtcatgccattctg
tgcgcacatccgctggtcggcgatgagccttttgccgtgatattgcctgacgttattctg
gatgaatacagcgcagatttaagcagcgataacctgagtgagatgctgcgtcgctatgag
tccaccggcgccagccagattatggttgagccggtgccgatggccgatgtttctaattat
ggcgtggtggattgcagcggtgcgcaattggctgcgggggaaagcattgctattcgcgcc
gtggttgaaaagccgccgcgcgataaggcgccgtctaacctgtctatcgttggccgctat
gttctctctccggacatttggccgttgctgtctaaaaccccgccgggagccggtgaggaa
attcagctgacggatgccattgccatgctgcttaagaatgaaaccgttgaggcttaccac
ctgaaagggcgtagccatgactgtggaaataagctgggctatatgcaggcgtttgtcgag
tatgggctacgtcatcctgcgctgggcaaagattttgcagcctggatcaaagggctgaat
ttaagcaagtaa

DBGET integrated database retrieval system