KEGG   Edwardsiella tarda EIB202: ETAE_1503Help
Entry
ETAE_1503         CDS       T01121                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase subunit
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00040  Pentose and glucuronate interconversions
etr00052  Galactose metabolism
etr00500  Starch and sucrose metabolism
etr00520  Amino sugar and nucleotide sugar metabolism
etr01100  Metabolic pathways
etr01130  Biosynthesis of antibiotics
Module
etr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ETAE_1503 (galU)
   00052 Galactose metabolism
    ETAE_1503 (galU)
   00500 Starch and sucrose metabolism
    ETAE_1503 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ETAE_1503 (galU)
Enzymes [BR:etr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ETAE_1503 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACY84344
UniProt: D0ZH68
Position
1613914..1614825
Genome map
AA seq 303 aa AA seqDB search
MSTSVRKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILV
THSSKNSIENHFDTSFELEAILEKRVKRQLLAEVQAICPKHVTIMQVRQGLAKGLGHAIL
CAHPLVGDEPFAVILPDVILDEYSADLSSDNLSEMLRRYESTGASQIMVEPVPMADVSNY
GVVDCSGAQLAAGESIAIRAVVEKPPRDKAPSNLSIVGRYVLSPDIWPLLSKTPPGAGEE
IQLTDAIAMLLKNETVEAYHLKGRSHDCGNKLGYMQAFVEYGLRHPALGKDFAAWIKGLN
LSK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgtcagtgagaaaagtaaaaaaagccgttatcccggtggccggattgggaacg
cgtatgctgccagcaacgaaagctattcctaaagaaatgttgccgctggtagataaaccg
ctgatccagtacgtggttaatgagtgtattgccgccggtattaatgagatcattttagtc
acgcattcatcgaagaactccatcgagaaccacttcgataccagctttgagctggaggcg
atccttgagaagcgcgttaagcgtcagctgctggccgaagtccaggccatttgtcctaag
cacgtgaccattatgcaggtgcgtcagggactggctaaaggtttaggtcatgccattctg
tgcgcacatccgctggtcggcgatgagccttttgccgtgatattgcctgacgttattctg
gatgaatacagcgcagatttaagcagcgataacctgagtgagatgctgcgtcgctatgag
tccaccggcgccagccagattatggttgagccggtgccgatggccgatgtttctaattat
ggcgtggtggattgcagcggtgcgcaattggctgcgggggaaagcattgctattcgcgcc
gtggttgaaaagccgccgcgcgataaggcgccgtctaacctgtctatcgttggccgctat
gttctctctccggacatttggccgttgctgtctaaaaccccgccgggagccggtgaggaa
attcagctgacggatgccattgccatgctgcttaagaatgaaaccgttgaggcttaccac
ctgaaagggcgtagccatgactgtggaaataagctgggctatatgcaggcgtttgtcgag
tatgggctacgtcatcctgcgctgggcaaagattttgcagcctggatcaaagggctgaat
ttaagcaagtaa

DBGET integrated database retrieval system