KEGG   Edwardsiella tarda EIB202: ETAE_1532Help
Entry
ETAE_1532         CDS       T01121                                 

Gene name
trpC
Definition
(GenBank) bifunctional indole-3-glycerol phosphate
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
etr  Edwardsiella tarda EIB202
Pathway
etr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etr01100  Metabolic pathways
etr01110  Biosynthesis of secondary metabolites
etr01130  Biosynthesis of antibiotics
etr01230  Biosynthesis of amino acids
Module
etr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAE_1532 (trpC)
Enzymes [BR:etr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ETAE_1532 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     ETAE_1532 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: ACY84373
UniProt: D0ZH97
Position
complement(1639978..1641354)
Genome map
AA seq 458 aa AA seqDB search
MTQPSPSPASLLSRIIADKRRWIAARERQQPLSDFQSTLRRSERDFHRALNATPRALILE
CKKASPSRGLIRADFDPQAIARVYRDHAAAISVLTDGDYFQGDFRYLRAVSDVVTQPVLC
KDFILSPYQIYLARHYRADAILLMLSVLDDAQYRQLAAVATALNMGILTEVSTPAEMARA
VALGARAIGINNRNLHDLSVDPERTRHLAALAPPGATLIAESGIHSHAQIRDLGRLVQGF
LIGSALMSQPDLRSAVCRLRFGDNKVCGLTRPEDAVSALCSGAVYGGLIFVADSPRYVDI
ATARGIISAAPLRYVGVFRDAKPASVALAAERLDLHAVQLHGGEDQAYIDSLRPLLPAAC
RIWKALPVSDTLPTARLHHVDRYLLDGVRPGSGHPFDWRLLDGHPLGDIMLAGGIGADNC
RAAADLGALGLDFNSAVESAPGRKDPRKLRAAFQALLA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccctcgccatcgcccgccagcctgctcagccgcatcatcgccgataaacgg
cgctggatcgccgcccgggaacggcagcagccgctgtcagactttcaatctaccctgcgg
cgcagcgaacgcgactttcaccgggcgctcaacgcgacgccgcgcgccctgatcctggag
tgtaaaaaagcatcgccttcgcgcgggctaatccgagctgactttgacccgcaggctatc
gcacgggtataccgcgatcatgccgccgccatctcggtcctaaccgacggcgactatttt
cagggtgacttccgctatctgcgcgcggtaagtgacgttgtcacgcagccggtgctgtgt
aaagacttcatcctctcgccttaccagatctatctggcgcgccattaccgcgccgatgcc
atcctgctgatgctctccgtattggacgatgcacagtaccgccagctggccgccgtggcc
acggcgctgaacatggggatcctcaccgaggtcagcacccccgccgaaatggcgcgcgcc
gtcgcgctgggcgccagggcgatcggtattaataaccgtaatctgcacgatctcagcgtc
gatcccgagcgtacccggcatctcgcggcgttggcgccgccgggcgcgacgcttatcgcc
gagtccggtatccacagccacgcccaaatccgcgacctgggtcgcctggtgcagggcttt
ttgatcggcagcgcgctgatgtctcagcccgatctgcgcagcgccgtctgtcgtctgcgc
tttggcgacaataaggtctgcggcctgacacgccctgaagacgcggtcagcgcgctgtgc
tccggcgccgtctacggtggcctgatcttcgttgccgactcgccgcgctacgtcgatatc
gccaccgcccgcggcattatttcggccgccccgctgcggtacgtcggggtctttcgcgac
gccaagcccgccagcgttgcgctggccgcagagcgcctggatctgcacgccgttcaactg
cacggcggcgaagatcaggcctatatcgatagcctgcgtccgctgttaccggcggcctgt
cggatttggaaggcgctgccggtcagcgataccctgcctaccgcgcgcctgcaccacgtc
gatcgctacctgcttgacggcgtacgccccggcagcggacacccctttgactggcgcctg
ctggatggacatcccctgggcgacatcatgctggccggggggatcggcgccgataactgc
cgcgcagcggccgacctcggcgcgctgggcctcgattttaactccgccgtggagtccgct
cccgggcgtaaagatcccaggaaactccgtgcggccttccaggcgctgctcgcctga

DBGET integrated database retrieval system