KEGG   Edwardsiella tarda EIB202: ETAE_1638Help
Entry
ETAE_1638         CDS       T01121                                 

Definition
(GenBank) hypothetical protein
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1741957..1742070
Genome map
AA seq 37 aa AA seqDB search
MRAGVSVAQLSLAQLSRRRAARLFSARGVRISPFYTS
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgccggcgttagcgtcgctcagctcagcttggctcagctcagccgtcgccgagcg
gcacggttattcagcgcccgcggcgtgcgtatctcccctttttatacatcgtga

DBGET integrated database retrieval system