KEGG   Edwardsiella tarda EIB202: ETAE_1639Help
Entry
ETAE_1639         CDS       T01121                                 

Definition
(GenBank) putative virulence-related membrane protein
  KO
K07804  
putatice virulence related protein PagC
Organism
etr  Edwardsiella tarda EIB202
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:etr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ETAE_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1742286..1742843
Genome map
AA seq 185 aa AA seqDB search
MKKQIAGLVLGAVGILTAQVAQAGSSTLSLGYAQSKVQNFKNMPGVNLQYRYEWDSALSV
MASLSVLQNDVDSTTHWWGVTSQDHVKARYNSLLIGPAWRLNEAVSLYAAAGMSHSQMAR
DYVSSAGQAPIHYADTVNALAYGGGVLVNLSAHVTANLGYEGSQTRVQGQRRHVNGVNVG
LGYRF
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacagatcgctggactggtattgggcgcggtggggatcctgactgcgcaggtg
gcgcaggccgggagcagtacgctgtcgctgggctatgcgcagagtaaggtacaaaatttt
aaaaacatgcccggcgtgaatctgcagtatcgctatgagtgggactccgcgctgagcgtg
atggcatcgctgagcgtgttgcaaaatgatgtggattcgacgacccactggtggggcgtc
acctcgcaggatcacgtgaaggcgcgctataattctctgctgatagggccggcctggcgg
ctgaatgaggccgtcagcctgtatgcggcggccggaatgtctcacagccagatggcgcgg
gactacgtcagcagcgcggggcaggcgccgattcactatgccgatacggtcaatgccttg
gcctatggcggcggcgtactggtcaacctgagcgcgcacgttacggcgaaccttggctat
gaggggtcgcaaactcgcgtgcaggggcagcgtcgtcacgtgaatggggttaacgtcggt
ctcggctaccgtttttag

DBGET integrated database retrieval system