KEGG   Edwardsiella tarda EIB202: ETAE_1640Help
Entry
ETAE_1640         CDS       T01121                                 

Definition
(GenBank) putative prophage protein
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1742931..1743290
Genome map
AA seq 119 aa AA seqDB search
MRRVCRWFSRALLLALPAMAAYAAPPEALRSPRPGVLCDRYLCADSQGISRALTTQYLGR
AATQRLFAQGDFDLTQFTFANGIFCDTHERLCRADRYYGPDGKHSGAVSAKYTALLFPR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
gtgagacgcgtttgtcgatggttttcccgcgcgctgttgctggctttgccggcgatggcg
gcctatgccgcgcccccggaggcgctgcgatcgccgcgccccggcgtgctgtgcgatcgc
tacctctgcgcggacagtcagggaatttcccgagcgcttacgacgcaatacctggggcga
gcggcgacgcagaggctcttcgcgcagggcgattttgacctgacccagtttacctttgcc
aacgggatcttctgcgatacccacgagcgcctgtgccgagcggatcgttactacggtcct
gacggtaagcacagtggcgccgtgtcggcaaaatatacggcgctgctgtttccccgctga

DBGET integrated database retrieval system