KEGG   Edwardsiella tarda EIB202: ETAE_1643Help
Entry
ETAE_1643         CDS       T01121                                 

Definition
(GenBank) DNA-binding protein
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1744679..1744888)
Genome map
AA seq 69 aa AA seqDB search
MPLQQLEQVTLARDEFEALRLVDREGLQQQQAAAEMGVSRQTLANILKRARFKLLDCLSN
GKALMIDEL
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgcagcagttggaacaggtcacgctggcgcgcgatgagtttgaagccctgcgg
ctggtcgatcgcgaggggttacagcagcagcaggccgccgcagagatgggcgtctctcgc
cagacgctggccaatattctcaagcgggcgcgctttaagctgctggactgtctcagtaat
ggcaaggcactgatgattgatgagctgtaa

DBGET integrated database retrieval system