KEGG   Edwardsiella tarda EIB202: ETAE_1651Help
Entry
ETAE_1651         CDS       T01121                                 

Definition
(GenBank) integral membrane protein, PqiA family
  KO
K03808  
paraquat-inducible protein A
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1755110..1756354)
Genome map
AA seq 414 aa AA seqDB search
MTRRVGVPTHRLRCPECDALCRLPTIDARQSAFCPRCDARLYDGRDWPLPRLAALSLTLL
VLLPLALFQPLLQIHLLGVTVQASVWQGIGQMAMQGEILTAGMVAFCAIVAPLLLPSLLL
ALYLGQRLRLNLRPLLLLLTLLRPWIMLDIYLIALAVAAIKVREYAAVDPGPALLAYIVA
TLLTLLLLIHLNLEQLWRRLYPQPPQTAPDSALLLCHACRHTAPPDAHGHCRRCRLPLHR
RQPYSLQKTWATLIAAVIILLPANLQPISILYVNGVRIEDTLLSGTLALANGGNLPIAAI
VFIASILVPFIKVAVMLFLLLGIHLRRGGDLVRRMRMLRLVTWIGRWSMLDLFVIALMMS
LIDRDQLFSFTMGAAAFYFGAAVFLTLLAVEWLDSRLIWDAHATTDANDTKYAQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgactcgccgagtcggcgtcccgacgcatcgtctgcgctgcccggagtgcgatgcgctg
tgccgtctcccgaccatcgacgcacgccagtccgccttttgtccgcgctgcgacgcccgc
ctgtatgatggccgagactggccgctgccccgcctcgcggcgctatcgctcaccctgctg
gtactcttgccgctggccctgtttcagccgctgctacagatccatctgctgggcgtcacg
gtgcaggccagcgtctggcagggcatcggacagatggccatgcagggcgagatcctcacc
gctggcatggtcgccttctgcgccatcgtagcgccgctgctgctgccctcgctgctgctg
gcgctgtacctcggccagcgactgcgcctgaacctgcgcccgctgctgctgctgctcacc
ctgctgcgcccgtggatcatgctggatatctacctgatcgcgctggccgtcgccgccatt
aaggtccgcgaatatgccgccgtcgatcccggtcccgcgctgctggcctatatcgtcgcc
accctgctgaccctgctgctgctgatccatctgaacctcgaacagctgtggcgccgcctg
tacccgcagccgccccaaacggcgccggacagcgcgctgctgctatgccacgcctgtcgc
catacggccccgccggacgcccacggacactgccgacgctgccgcctaccgctgcaccgc
cgtcagccctacagcctgcaaaaaacctgggccaccctgatcgccgccgtgatcatcctg
ctgccggccaacctgcagcccatctcgatcctgtacgtcaacggcgtgcgcatcgaggac
accctgctctcgggaacgctcgccttggccaacggggggaatctgccgatcgccgcgatc
gtctttatcgccagcatcctggtgccctttatcaaggtggcggtcatgctgttcctgctg
ctgggcatacacctgcgccgcgggggcgacctggtgcggcgcatgcgcatgctgcggctg
gtcacctggatcggtcgctggtcgatgctggacctgtttgtcattgcgctgatgatgtcg
ctaatcgatcgcgaccagctgttctcgtttaccatgggcgcggcggccttttatttcggc
gccgcggtatttctgacgctgctggccgtggaatggctggacagtcgactgatatgggat
gcacatgccacaaccgacgccaacgacacaaaatacgcccaataa

DBGET integrated database retrieval system