KEGG   Edwardsiella tarda EIB202: ETAE_1652Help
Entry
ETAE_1652         CDS       T01121                                 

Definition
(GenBank) GAF domain-containing protein
  KO
K08968  
L-methionine (R)-S-oxide reductase [EC:1.8.4.14]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAE_1652
Enzymes [BR:etr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.14  L-methionine (R)-S-oxide reductase
     ETAE_1652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1756581..1757072
Genome map
AA seq 163 aa AA seqDB search
MSKETFYTDMARDLSALCSGEFNAIATLSNVSALLYERLPAVNWAGFYFLDGQTLVLGPF
QGKLACVRIPVGRGVCGTACATGQVQRVGDVHRFDGHIACDAESNAEIVLPLVVNGRTIG
VLDIDSTQFERFDEEDEKGLKSVVGALCQHLERCDWAKFVTFA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagagacgttttataccgatatggctcgcgatctgagcgcgctgtgtagcggt
gaattcaacgcgattgccacgctgtccaacgtgagcgccctgctgtatgagcgcttgccc
gcggtgaactgggccggtttttattttctggatgggcaaacgctggtgctggggccgttt
cagggcaaactggcctgcgtacgcattcccgtggggagaggggtctgcggtacggcctgc
gctacggggcaggtgcagcgcgtgggggatgtgcaccgtttcgatggtcatatcgcctgt
gacgcggagagcaatgcggaaatcgtgctgccgctggtggtcaacgggcggacgatcggg
gtgctggatatcgatagcacacagtttgagcgcttcgacgaagaagatgaaaaaggcctg
aaaagcgtggtgggcgcgctctgccagcatctggagcgctgcgactgggcaaaatttgtg
acttttgcttaa

DBGET integrated database retrieval system