KEGG   Edwardsiella tarda EIB202: ETAE_1653Help
Entry
ETAE_1653         CDS       T01121                                 

Gene name
proQ
Definition
(GenBank) putative solute/DNA competence effector
  KO
K03607  
ProP effector
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1757174..1757878
Genome map
AA seq 234 aa AA seqDB search
MENQPKLNSSKEVIAFLAQRFPQCFSTEGEARPLKIGIFQDLVARMQGEENGLSKTQLRS
ALRLYTSSWRYLHGVKLGAERVDLDGNACGVLDEQHVEHARQQLEEAKARVQAQRDARKR
EAAENGEKREPRRPRPAGKKPTVRRDAEQGSKEVRKPRAAKATQERKPRAKSETTEQRST
PVTSLEQLHLGQTVKVSAGKHAMEASVLEITKDGVRVQLSNGLAMIVRTEHLQF
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaaccaaagttgaacagtagtaaagaagtcatcgcctttttggctcaacgt
ttccctcagtgcttcagcaccgagggtgaagcccgcccgttaaagatcggcatctttcag
gatctggttgcgcggatgcagggggaagaaaacggcctgagcaagactcagctacgttca
gcactccgcctttacacatccagctggcgctacctgcacggggtaaaactgggtgcagag
cgtgtcgatctggatggcaacgcctgcggcgtgctggacgagcagcacgtagagcatgcc
cgtcagcagctggaagaggccaaggcccgggtccaggcacagcgtgacgcccgcaagcgc
gaagccgccgaaaacggcgaaaagcgcgagccgcgccgtccgcgtccggcgggtaaaaag
cccaccgtgcgccgtgacgctgagcagggcagtaaagaagtgcgtaaaccgcgtgccgcc
aaggctacgcaggagcgcaaaccgcgcgccaagagcgagaccacggaacagcgcagcacc
ccggtgacctcgctggagcagctgcacctggggcaaaccgtgaaggtcagcgccggtaag
catgccatggaggcatccgtactcgagatcaccaaagacggtgtacgtgtccagctgtct
aacggtctggcaatgattgtacgcacagaacacttgcagttctga

DBGET integrated database retrieval system