KEGG   Edwardsiella tarda EIB202: ETAE_1656Help
Entry
ETAE_1656         CDS       T01121                                 

Gene name
malS
Definition
(GenBank) periplasmic alpha-amylase precursor
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ETAE_1656 (malS)
Enzymes [BR:etr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ETAE_1656 (malS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1760122..1762059
Genome map
AA seq 645 aa AA seqDB search
MKYAVFAALLLPLAAGADWRSPAFPQFVAVDEGRFSASQPLAKGEAPRWRRFRDGRYQAL
VDTRSGTPTLTLSVHDEAAQRAAAAARRCPRWDGRPLRVPVDRAFSEGSLVRDFYSGEVA
RVTQGTVTLQPALGSNGLLLLESAETAGPAPFDWHNATVYFVLVDRFANGDPSNDNSYGR
QKDGMQEIGTFHGGDLRGLTGQLDYLQRLGVNVLWISSPLEQIHGWVGGGSRGDFPHYAY
HGYYPLDWTRLDANMGSEQDLRALVEGAHRRGIRVLFDVVMNHTGYATLADMQQYQFGAL
FLQGETLRQTLGTHWRDWRPGRGQTWHSFNDYIDFGNRAAWARWWGKGWIRTDIGDYDAP
GFDDVTLSLSFLPDVKTESSAASGLPIFYRHKPDTRAREIPGYTPRDYLTHWLSQWVREY
GIDGFRIDTAKHVEPAAWQQLKQQASAALAEWKRANPQQALDDAPFWMTGEAWGHGVMRS
AYYRHGFDAMINFDYQEQAARAQGCLADIDPLWQQMAAQLQDFNVLSYLSSHDTCLFRSD
GSGAAALLLLAPGAVQIFYGDESGRPLGPTGSDPLQGTRSDMNWQDIRGPAAAQVAHWQR
LGQFRARHPAIGKGEQTTVAMPQGYGFIRNDGRDRVMVVWAGQPE
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgccgttttcgccgcactattgctgccgttggccgccggggccgactggcga
tcgcccgcgtttccccagttcgtcgccgtggacgaggggcgctttagcgccagtcagccg
ctggccaaaggcgaggcgccgcgatggcggcgcttccgggatggccgctaccaggccctg
gtcgatacccgctcgggaacgccgacgctgacgctgtccgtacacgatgaggccgcgcag
cgggcggcggcggcggcgcggcgctgtccacgttgggatgggcgtccgctgcgcgtaccg
gtcgatcgggcctttagtgaaggcagcctggtgcgcgatttttacagtggagaggtcgcc
cgcgtcacccagggcacggtgaccctgcagccggcgctgggcagcaatggcctgctgctg
ctcgaatcggctgaaaccgcggggccggcgccgttcgactggcacaacgcgacggtctat
tttgtcctggtcgatcgcttcgccaacggcgatcccagcaacgataatagctatggtcgc
cagaaggacgggatgcaggagatcgggacctttcacggcggcgatctgcgcgggctgacc
ggccagctcgactatctccagcgtctgggggttaatgtcctgtggatcagctcgcccctt
gagcagatccacggctgggtcgggggcggtagtcggggcgacttcccgcactatgcctat
catggttactacccgctggactggacgcggctggatgccaatatgggcagcgagcaggat
ctgcgggcgctggtggagggggcccaccggcgcggtatccgagtgctgttcgacgtggtg
atgaaccataccggctatgcgacgctggcggatatgcagcagtaccagttcggcgcgctg
ttcctgcagggggagacgctgcggcaaacgctgggcacccattggcgcgactggcggccg
gggcgcggccagacgtggcatagctttaatgactatattgatttcggcaatcgcgcggcg
tgggcgcgctggtgggggaaggggtggatccgtaccgatatcggcgactatgatgccccg
ggattcgatgatgttacgctgtcgctctcttttctgccggatgtgaagaccgagtctagc
gcggcgtccggtttgccgatcttttatcgtcataagccggatacccgcgcccgggagatc
cccggctacacgccgcgagactacctaacccactggctcagtcagtgggtgcgtgaatac
ggcatcgatggctttcgcatcgacacggcaaagcacgtagagccggcggcctggcaacag
ctgaagcagcaggctagcgcggccttggccgaatggaagcgggctaatccgcagcaggcg
ttggacgatgcccccttctggatgaccggcgaggcctgggggcacggcgtgatgcgcagc
gcctattatcgtcacggcttcgatgcgatgatcaattttgactatcaggagcaggcggcg
cgggcgcagggctgtctggccgatatcgatccgctgtggcagcagatggcggcgcagctg
caggattttaacgtgctgagctatctgtcgtcccatgatacctgtctgtttcgcagcgac
ggcagcggcgccgcggcgctgctgctgctggcgccgggcgcggtgcagattttctacggc
gatgagtcggggcgtccgctggggccaacgggatctgatccgctgcagggcacccgttcg
gatatgaattggcaggatatccgcggcccggcggcggcgcaggtcgcgcactggcagcgc
ctggggcagttccgcgcccgccatcccgctatcggcaagggggagcagacgaccgtcgcg
atgccgcagggctacggctttatccgcaatgatgggcgggatcgggtgatggtggtctgg
gccggtcagccggagtag

DBGET integrated database retrieval system