KEGG   Edwardsiella tarda EIB202: ETAE_1673Help
Entry
ETAE_1673         CDS       T01121                                 

Definition
(GenBank) ABC transporter permease protein
  KO
K05778  
putative thiamine transport system permease protein
Organism
etr  Edwardsiella tarda EIB202
Module
Putative thiamine transport system
Brite
Transporters [BR:etr02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative thiamine transporter [MD:M00192] [OT]
    ETAE_1673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1782649..1784271)
Genome map
AA seq 540 aa AA seqDB search
MSRLVLFPALVLLSGALPLAAMVPATLLPLTEQNAGQALLQLLQWPALGRSLALSLWIAL
GSSGGALLLALALAGLTLRRQRQHTLAPALLLAAPHIALATGLLMLLAPTGLLWRLMAPL
FDWQQPPDLPLPNDPYGLSLSLLLLLKETPFFYLLTLNLAARCAAQRQLRISAALGYPPA
QGWWRIVVPQLLPGLRLPMFCVLAFALSALDLAQLLGPQRPLLFAQLLWQWIADGGQTAL
AALGALLLMLLNALALLLWYGIEHLWVAVGRRPPRRRVARGGPAPYAAFWPLALALAAAA
YLMLVLISLAQRWPFAQRWPRQWRYDSWLYSVSDWSAPLWHTLCIALAVNLLALILALGT
LEWYTLRRRAPGARLLLPLLLPQMGLIFGLQYFAARSQLLGSYPLVIYGQLLFVTPYYLL
TLSGAWLRFDTRQTQVALALGKTPWQAFYRIKLPQMLPALLLAMAFGLAVSVGMYLPTLG
LGAGRLPTLATETVAYASGIDRRLAAIGALWQTLLPLPAFLLALWLPLRGIRGATSHGHP
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccggctggtcctgtttcccgcgctggtgctgctgtccggcgcactaccgctggcg
gcgatggttccggcgaccctactgccgctgaccgagcaaaatgcgggacaggcgctgctg
cagctgctgcagtggcccgcgctgggccgcagcctggctctgtcgctgtggatagcgcta
ggctcctccggcggcgccctgctgctggcgctggcgctggccgggctcaccctacggcgt
cagcgtcagcacacgctggcgccggcgctgctgctggcagccccccacatcgccctggcc
accggcctgctgatgctgctggcgccaaccggcctgctgtggcgcctgatggcgccgctg
tttgactggcagcagccgcccgatctgccgcttcccaacgatccctacggcctgagcctc
tcgctgctcctgctgttaaaagagaccccctttttctatctgcttaccctgaatctggcc
gcccgctgcgccgcgcagcggcagctgcgcatcagcgccgcgctgggctatcccccggcg
cagggctggtggcgcatcgtggtgccgcagctgctgccggggctacgcctgcccatgttc
tgcgtcctggcctttgccctgtcggcgctggatctggcgcagctgctcggtccgcagcgg
ccgctgctgtttgcgcagctgctgtggcagtggattgccgacggtggacagacggcgctg
gcggccctcggggcgctgctgctgatgctcttaaacgcgctggcgctgctgctctggtat
ggcattgaacacctgtgggtcgccgtgggtcgccgtcccccgcgacggcgcgtcgcccgc
ggtgggcctgcgccctacgccgccttttggcctttggcgctggcgctggccgccgcggcc
tacctgatgctggtgctgatttccctggctcagcgctggccctttgcgcaacgctggccg
cggcagtggcgctatgacagttggctgtacagcgtcagtgactggagcgccccgctgtgg
cataccctgtgcatcgcgctggcggtcaacctgctggcgctgatcctggcgctcggcacg
ctggagtggtataccctgaggcgacgggcccccggcgcccggctgctgctgccgctgctg
ctgccgcagatggggctgatcttcggtctacagtatttcgccgcccgcagccaactgctg
ggcagctacccgctggttatctatggccagctgctgttcgtcaccccctactacctgctg
acgctgtccggtgcctggctgcgtttcgatacgcgtcagacccaggtggcgctggcgttg
ggtaagacgccctggcaggccttttaccggattaagctgccgcagatgctgccggcgctg
ctgctggcgatggcctttggcctcgcggtcagcgtcggcatgtatctgccgacgctgggg
ctgggcgccgggcggctgccgacgctggccacggaaaccgtcgcctatgccagcggcatc
gatcggcgcctggccgccatcggcgccctatggcaaaccctgctaccgctgccggcattt
ttgctggcgctatggctaccgctgcgcggtatacgaggagcaacgtcgcatggccaccct
taa

DBGET integrated database retrieval system