KEGG   Edwardsiella tarda EIB202: ETAE_1674Help
Entry
ETAE_1674         CDS       T01121                                 

Gene name
purR
Definition
(GenBank) DNA-binding transcriptional repressor
  KO
K03604  
LacI family transcriptional regulator, purine nucleotide synthesis repressor
Organism
etr  Edwardsiella tarda EIB202
Brite
Transcription factors [BR:etr03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    ETAE_1674 (purR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1784276..1785301)
Genome map
AA seq 341 aa AA seqDB search
MATIKDVAKRAGVSTTTVSHVINKTRFVADETKAAVWEAIKELHYSPSAVARSLKVNHTK
SIGLLATSSEAPYFAEVIESVENSCYSQGYTLILCNSHNNLEKQKAYLAMLAQKRVDGLL
VMCSEYPENLLEILEDYRHIPMVVMDWGTRRSDFTDAIQDNAFEGGYLAGRYLIERGHRD
IGAITGPVSRNTGGGRLRGFLKALQEANITPQESWLVEGDFEPESGYAAMQNILSQKQRP
TAVFVGGDIMAMGAICAADEMGLRVPQDISVIGYDNVRNARYFTPALTTIHQPKERLGAM
AFDMLLDRITSKREDAQTIEVHPKLVERRSVADGPFIDYRR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgattaaagatgtggcaaagcgcgcaggcgtatcgaccaccacggtgtctcac
gtcatcaataaaacccgctttgtcgccgacgagaccaaagccgccgtctgggaggccatt
aaagaactacactactcccccagcgccgttgcccgcagcctgaaggtcaaccacaccaaa
tccatcggcctgctggcgacctctagcgaggcgccgtactttgccgaggtcatcgagtcg
gtagagaatagctgctacagccaaggctataccctgatcctgtgtaactcccacaataat
ctggagaagcagaaagcctacctggctatgctggcgcaaaagcgcgtcgacggcctgctg
gtgatgtgctccgaatatccggagaacctgctggagatccttgaggactaccgtcatatc
ccgatggtggtcatggactggggcacccgccgcagcgactttaccgatgctatccaggac
aacgccttcgagggcggctatctggccggccgctacctgatcgagcgcggccaccgcgac
attggcgccatcaccggcccggtatcgcgcaacaccggcggcggtcgcctgcgcggtttc
ctcaaggcgctgcaggaggccaacatcacgccgcaggagagctggctggtcgaaggcgac
ttcgagccggagtctggctatgcggcgatgcaaaacattctgtcgcagaagcagcgcccg
acggcggtgtttgtcggcggcgatatcatggcgatgggcgccatttgcgccgcggacgag
atggggctgcgcgtaccgcaggatatttccgtcatcggctacgacaacgtgcgcaacgcc
cgctactttaccccggcgctgaccaccattcatcagcccaaggagcgccttggcgccatg
gcattcgacatgctgctcgatcgcatcaccagcaagcgcgaagacgcccaaaccatcgaa
gtgcatcctaagctggttgagcgtcgctccgtggccgacgggccgttcatcgactaccgc
cgctaa

DBGET integrated database retrieval system