KEGG   Edwardsiella tarda EIB202: ETAE_1680Help
Entry
ETAE_1680         CDS       T01121                                 

Definition
(GenBank) putative permease
  KO
K07084  
putative amino acid transporter
Organism
etr  Edwardsiella tarda EIB202
Brite
Transporters [BR:etr02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ETAE_1680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1788371..1789693)
Genome map
AA seq 440 aa AA seqDB search
MNAVVIAVVVMLLLSLLRVNVVIALIVASLVAGLSGGLTLDTTITTFSGGLGGGAEIALS
YAMLGTFAVAISRSGITDVLAHGVIRRMGLTPSAHRLFWFKYGLLLILTLIAISSQNLIP
IHIAFIPILIPPLLHVFSRMNLDRRAVACVLTFGLITPYMVLPIGFGGIFLNNILLKNLN
ENGLQVTAAQVPSAMLLPGLGMLFGLLLAIFFSYRRPRRYNEGRILSAEPEHKRIHLRAV
WVAVIAIIAALGVQLATNSIVLGALMGFVVFILGGVIHWRDTQDVFTRGVHMMAMIGFIM
ITASGFAAVIKATGSVDTLVTSIEGAIGGNRGLAAFLMLVVGLVITMGIGSSFSTVPIIA
AIYVPLCIAFGFSPMATIAIIGVSGALGDAGSPASDSTLGPTSGLNMDGQHDHIWDSVVP
TFLHYNLPLLGFGWAAAMIL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgttgtaattgccgtggtcgtaatgctgctgctcagcctgctgcgggttaac
gtggtgatcgccctgatcgtcgcctctctggttgccggcctgagcggcggtctcaccctg
gacaccacgatcacgaccttcagcggtgggctgggcggcggcgcggagatcgccctcagc
tacgccatgctgggtacctttgccgtcgcgatttcacgctctgggatcaccgacgtgctg
gcccacggcgtgatccgccgcatggggctgacgccgagcgcccaccgcctgttctggttt
aaatacggtctgctgctgatcctgaccctgatcgccatctcgtcgcagaacctgatcccc
atccacattgcctttattcccattctgatcccgccgctgctgcacgtattttcgcggatg
aacctcgatcggcgcgcggtagcctgcgtgctgaccttcggcctgatcaccccttatatg
gtgctgccgatcggctttggcggcatcttcctgaacaatattctgctgaagaacctcaat
gagaacgggctacaggtcaccgccgcccaggtgcccagcgccatgctgctgccggggctg
gggatgctgttcggcctgctgttggccatcttcttcagctaccgcaggccgcgccgctac
aacgaggggcgcattctgtccgccgagccggagcataagcgtattcatttacgggccgtg
tgggtcgccgttatcgccatcatcgccgccctcggggtgcagctggcgaccaactctatc
gtgctcggcgcgctgatgggctttgtggtgtttattctcggcggcgtgatccactggcgg
gatactcaggatgtctttacccgcggggtgcatatgatggcgatgatcggctttatcatg
atcaccgcctccgggtttgccgccgtgatcaaagccaccggcagcgtagatacgctggtg
acctctatcgagggggcgatcggcggcaaccggggactggctgcgtttctgatgctggtg
gtcgggctggtcatcaccatgggcatcggctcctccttctccacggtgccgatcatcgcg
gcaatctatgtgcccctgtgcattgcctttggcttctcccccatggcgaccatcgccatt
atcggcgtctccggggcgctgggggatgccgggtcgccggcctctgactctaccctgggg
ccaacctctgggctgaatatggacggccagcacgaccatatctgggattcggtggtgccg
accttcctgcactacaacctgccgctgctcggcttcggctgggcggcagcgatgatcctc
tag

DBGET integrated database retrieval system