KEGG   Edwardsiella tarda EIB202: ETAE_1681Help
Entry
ETAE_1681         CDS       T01121                                 

Gene name
rnt
Definition
(GenBank) ribonuclease T
  KO
K03683  
ribonuclease T [EC:3.1.13.-]
Organism
etr  Edwardsiella tarda EIB202
Brite
Enzymes [BR:etr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-  
     ETAE_1681 (rnt)
Transfer RNA biogenesis [BR:etr03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    ETAE_1681 (rnt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1789853..1790617)
Genome map
AA seq 254 aa AA seqDB search
MPPAPLLICHPRVKHGKICHNARCIQNKDTNELMADTSNLNALSARFRGFYPVVIDVETA
GFDANRNALLEIAAVTLRMNDDGWLETDQCLHFHITPFEGAVLSPEALAFNGIDPHNPLR
GAVSEYTALHAIFKMVRKGIKDQACNRAVVVAHNAHFDHSFLMAAAERAGLKRNPFHPFA
TFDTAALSGLVLGQTVLAKACLSAEIPFDSAQAHSALYDTQQTATLFCELVNRWKRLGGW
PPAYLNDTAPSAEA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcccgcgcccctgctcatttgccatccccgtgtaaaacacggcaaaatttgccat
aatgcgcgctgcattcaaaataaagacaccaacgaactcatggctgacacctctaatctc
aatgcgctgagcgcgcgctttcgcggcttttacccggtcgtcatcgacgtcgaaaccgca
ggctttgacgccaatcgcaacgccctgctggaaattgccgccgtcactctacgaatgaac
gacgacggctggctggaaaccgatcagtgcctgcatttccatatcaccccctttgaaggc
gccgtgctctcgccagaggcgctggcctttaacggaatcgatccgcacaacccgctacgc
ggcgccgtcagcgaatataccgcgctgcacgccatctttaagatggtgcgcaagggaatt
aaagatcaggcgtgcaatcgcgcggtggtcgtggcccacaacgcccactttgaccactcg
tttctgatggcggccgcagagcgcgccgggctgaagcgcaacccgttccatccgttcgcc
accttcgataccgccgccctcagcgggctggttctcggtcaaacggtgctggccaaagcc
tgcctcagcgcggagatccccttcgacagcgcccaggcccattcggccctgtatgatacc
cagcagaccgccacgctgttctgtgagctggtgaaccgctggaaacgcctgggcggctgg
cccccggcctacctgaacgataccgccccctccgcagaggcataa

DBGET integrated database retrieval system