KEGG   Edwardsiella tarda EIB202: ETAE_1711Help
Entry
ETAE_1711         CDS       T01121                                 

Definition
(GenBank) probable LysR-family transcriptional regulator
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1820014..1821006
Genome map
AA seq 330 aa AA seqDB search
MSNILIRTNNIFKVSIAMRIEIRHLKYFIAVAEERHFNRAAERLNISQPPLSQQIQALER
ELGACLLMRTNRSVSLTQAGSLFLKECYAIVGQLEQAAEKAARAHRGETGDLTIGFTSSV
PFIPRVAHSLFAYRHRYPQVHLQMRELNTKQQIEPLVEGKLDIGILRNTQLPGVLTHRVL
QREPLVAVLHRHHPLAQRGQALKFCDLADQPFVFFSRGDGTALYDELLSLLKRAGIVPYI
TQEVGEAMTIVGLISAGLGVSILPASYTRIQVDGVCYRALDEPDAYTEVWLAYHRQRPLS
AQANALIALLTAPSADAMVAPAMLENPPNG
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatatattaataagaaccaataatatatttaaagtatcaatagccatgcgcatc
gaaattcgtcatctaaagtactttatcgccgttgccgaggagcgacatttcaaccgggcg
gcggagcggctgaatatctcccagccgccgctgagccagcagatccaggcgctggagcgt
gagttgggcgcctgtctgctgatgcgcaccaaccgcagcgtcagtctgacgcaggcgggg
agcctttttctgaaagagtgctatgccatcgttggccagctggagcaggcggcagaaaag
gcggctcgagcacatcgaggggagaccggggatctgaccattggctttacctcatcggtc
ccctttattccccgggtggcgcacagcctattcgcctaccgccatcgctatccgcaggtg
catctgcaaatgcgcgagctcaataccaagcagcagatcgaaccgttggttgagggaaag
ctggacatcggcattttgcgcaatacccaactgcccggcgtgctgacgcaccgggtgctg
cagcgcgagccgctggttgcggttttacaccgtcatcatcctttggcgcagcgggggcag
gcgctgaagttctgcgacttggccgaccaaccctttgtctttttttcccgcggcgatggt
acagcgctgtacgatgaactgctgtcgctgctgaagagggccggcattgtgccgtatatt
acgcaggaggtcggcgaggcgatgacgatcgtcggactgatctcagcagggctgggcgtc
tctattctgccggcctcctatacccgtattcaggtggacggtgtgtgttatcgcgcattg
gatgagcccgacgcctataccgaggtgtggctcgcctaccaccgccagcgtccgctgagc
gcacaggccaatgcgctgatcgcgctgctgaccgcgccatccgccgacgccatggtggcg
ccagccatgctggaaaacccaccgaatgggtaa

DBGET integrated database retrieval system