KEGG   Edwardsiella tarda EIB202: ETAE_1715Help
Entry
ETAE_1715         CDS       T01121                                 

Gene name
yhjA
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
etr  Edwardsiella tarda EIB202
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1823311..1824774)
Genome map
AA seq 487 aa AA seqDB search
MKKITKWAGGIVIAGLACYLGLVGYVYNHDKQRNTVPSEPASSPLNAQVLGILSEKGCDY
CHTPSANLPFYASVPGVKQLMEYDMYQGYKAFNLTPLRESLLKPSPWKTASGQPPTLTDL
NKLEWVVQHQTMPPTRYTAMHWAGRMSQADRDTLLTWVDEQRQKYYATPDMAPSLRNEPI
QPIPESLPVNAEKVALGFRLYHDPRLSSNDTVACAHCHQLGAGGVDGRKTSLGVDDQVGP
INAPTVFNSAFNIAQFWDGRAATLQDQAGGPPLNPIEMASTSWEQIIDKLNQDQAFKQAF
LKVYPQGFSGKTITDAIAEFERTLITPNSAFDRYLRGDSSALTAQQQRGYQLFKDNRCAT
CHAGVAMGGESYEPLGLIKAYPFGEMTSADIGRMNVTQDLRDKLRQKVPTLRNVELTGPY
FHRGDVQTLDEAVKQMLRYQVGVTLPQSDVDDIVAFLKSLNGVYTPYPMNTAAAEAPATP
TTETAHP
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataacgaaatgggcgggaggcatcgtcattgccggtctcgcctgctactta
gggttggtcggctatgtctataatcatgacaaacagcgtaataccgtaccgagtgaaccg
gcaagttcaccgcttaatgcgcaggtattggggatactgagcgaaaaaggctgtgactac
tgccatacaccatcggctaatttgccgttttacgccagcgttcccggcgtgaaacagctg
atggagtatgacatgtatcagggatataaggcgttcaacctgactcccctgcgcgaaagt
ctgctgaaaccctccccgtggaaaaccgccagcggccaaccgccgaccctgacggatctc
aataagctggaatgggtggttcagcatcaaaccatgccgccaacccgctataccgcaatg
cactgggccggtcggatgtcgcaggccgatcgcgatacgctgctgacgtgggtggatgag
cagcgtcaaaaatactatgcaacgccggatatggcgccctcgctgcgcaatgagccgata
cagccgatccctgagtctttaccggtcaacgccgaaaaagtcgcgctgggattccgtctg
taccacgatccgcgcttatccagcaatgacaccgtggcctgcgcccactgtcaccagctg
ggcgccggtggcgtcgatgggcggaaaacatcgctcggcgtcgatgaccaggttggcccc
atcaacgcgccaacggtgtttaactctgcgttcaacatcgcccagttctgggatggccgt
gcggcaaccctgcaggatcaggccggtgggccaccgctgaatccgatcgagatggcgtcc
acatcgtgggagcagatcatcgataagctgaatcaagatcaggcatttaagcaggcgttc
ctcaaggtatatccgcagggcttcagtggaaaaaccatcactgacgccatcgccgagttt
gagaggaccctgattacgccgaactccgcgtttgaccgctacctgcgcggcgatagcagc
gcgctcacggcccagcagcagcgtggctatcagctatttaaggataaccgctgcgcaacc
tgccacgccggcgtggccatggggggagagtcttacgagccactcgggctgatcaaggca
tatccgtttggcgaaatgaccagcgcggacatcggtcggatgaacgtcacccaggatctg
cgcgataagctgcgccagaaggtaccgacgctgcgtaacgttgagctgaccgggccctac
ttccaccgtggcgatgtgcagacgctggatgaggccgtgaagcagatgctgcgctatcag
gtcggcgtcaccctgccgcaaagcgatgtcgacgatatcgtggccttcctgaagagcctg
aacggtgtctatacgccgtacccgatgaacacggccgccgcagaagctccggcgacgcca
acgacggagacggcccatccgtag

DBGET integrated database retrieval system