KEGG   Edwardsiella tarda EIB202: ETAE_1720Help
Entry
ETAE_1720         CDS       T01121                                 

Definition
(GenBank) putative porin
  KO
K10124  
carbohydrate-specific outer membrane porin
Organism
etr  Edwardsiella tarda EIB202
Brite
Transporters [BR:etr02000]
 Other Transporters
  Pores ion channels [TC:1]
   ETAE_1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1829513..1830904
Genome map
AA seq 463 aa AA seqDB search
MSQGNKLKAKILIILSALYSGALLASSPSVEQRLDALEKQEAERQRAAASPSDDLWLRYS
GYFRGGWASSSRGSPRPYAVGSLGRLGDEYGAWFDLRLDKRVYANQGKTVNAVVQLDGNV
SNAYTTAWFNTFEDNLLQFSNLYVTTTGFIPFMPETTFWVGKNALPFYEIQMLDWKANWA
VSAGGVGLENIKAGPGNIDVTLLRQDLKLYARDYNTSTPVNTNAIELRYKDIPLWHNATL
DIAARYNLANRSHAAKSNEYFSIQDAWLAAGIVRQRFENGGFNEFVIQAANNSVASGFMS
ISDANPHYGDGVYYHGDHNNGNAFRLISQGEMYLHPKIIMANALVYAWGHDVYSYASGAH
TDFDSFRAVLRPAYIWNDFNQSGVEVGWFNQVNRANRGRYHEEGYKMTLYHAFKVDTSML
RSRPEIRFYTTWIKTLHNDISQFSFEDERPEQFSFGVQAEIWW
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaggaaataagctaaaggcaaaaatattgataatcttatcggcgctgtattcg
ggggctctactggcctcatcgccttccgtcgagcagcgtctggatgcgctggagaaacag
gaggccgagcgccagcgggcggctgcgtcgccgagtgatgatctgtggctccgctacagc
ggttactttcgcggcggctgggcaagcagcagtagaggcagcccgcgtccctatgccgtt
ggctccctggggcgcttgggggatgagtatggcgcctggtttgatctccgcctggataag
cgtgtttacgccaaccaagggaaaacggtcaatgcggtggtacagctggatggtaacgtc
agcaacgcttatacgacggcctggtttaatacgtttgaagacaatctgctgcagttttca
aacctgtatgtcaccaccaccggctttatcccgtttatgccggagacaaccttttgggtg
gggaaaaatgcgctgccgttctatgagattcagatgctggattggaaggccaactgggcc
gtatcggcgggcggtgttggcttggagaatataaaagcagggcctggaaatatagacgtt
acgctgctgcgccaggatttaaagctttacgctagggattacaacaccagtacgccggtg
aataccaacgccatcgagctccgctataaagatatcccgctgtggcataacgcaacgctg
gatattgcggccagatacaacctggctaatcgcagtcacgcagccaaatcaaatgaatac
ttctccattcaggatgcctggttagctgcgggaatcgtacggcagcgctttgaaaacggc
ggatttaacgagtttgttattcaggcagccaataactctgtggccagtggctttatgagt
atctctgatgccaatcctcactatggcgacggcgtgtattatcacggcgatcataataat
ggcaacgcctttcgcctaatctcgcagggggagatgtacctacaccctaaaatcatcatg
gctaacgcattggtgtatgcatggggacacgatgtgtatagctatgccagcggggcgcat
accgattttgactcattccgcgccgtgctacgtcctgcatatatatggaatgactttaac
cagagcggcgttgaggtcggctggtttaaccaggtgaatcgggcaaatcgcggccgctat
catgaagagggatataagatgacgctatatcacgcgtttaaagttgataccagcatgctg
cgctcccgtcctgaaattcgtttctatacgacctggattaagacgctgcataatgatatc
tcacagttctcttttgaggatgagcgtcccgagcaattcagctttggggtgcaggctgaa
atctggtggtaa

DBGET integrated database retrieval system