KEGG   Edwardsiella tarda EIB202: ETAE_1724Help
Entry
ETAE_1724         CDS       T01121                                 

Definition
(GenBank) short-chain alcohol dehydrogenase of unknown specificity
  KO
K16066  
3-hydroxy acid dehydrogenase / malonic semialdehyde reductase [EC:1.1.1.381 1.1.1.-]
Organism
etr  Edwardsiella tarda EIB202
Pathway
Pyrimidine metabolism
Glycine, serine and threonine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ETAE_1724
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ETAE_1724
Enzymes [BR:etr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.381  3-hydroxy acid dehydrogenase
     ETAE_1724
    1.1.1.-  
     ETAE_1724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1833266..1834015)
Genome map
AA seq 249 aa AA seqDB search
MNVFITGATAGFGAAIARKFIRHGHHVIAAGRRLERLEALRDELGDTLTVVQLDVRNRAA
IQDAIAHLTPVQRTIDLLVNNAGLALGLEPAHQADIDDWETMIDTNVKGVVNMTRALLPE
MVARNAGHIINIGSTAGSWPYAGGNVYGATKAFVRQFSLGLRADLHGTRIRVSDIEPGLV
GGTEFSSVRFKGDEQRVTRTYQDAHALTADDIAEAVFWVATLPPHVNINTMEMMPVSQSF
SPLAVYRGE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttttcattaccggggctaccgccgggtttggtgcggcgatcgcccgtaagttt
atccgccatggccaccacgttatcgccgccggacggcgcctcgagcggttggaggcgcta
cgcgatgaactgggcgatacgctgacggtcgttcagctggatgtccgcaaccgggccgct
atccaggatgcgatcgcgcacctgacgccggtgcagcgcacgatcgatctgctggtcaat
aacgccggactggctctggggctggagcccgcccatcaggcggatatcgatgactgggaa
accatgatcgacaccaacgtcaaaggcgtcgtgaacatgactcgcgccctgctgccggaa
atggtcgcccgcaacgcgggtcatattatcaatatcggctcaacggcgggcagctggccc
tacgccggcggcaatgtctatggcgcgaccaaggcctttgtccgccagttcagccttggc
ctgcgggccgatctgcacggaacccgaatccgggtaagcgacattgagcccggcctggtc
ggcggtaccgaattctccagcgtccgctttaaaggcgacgagcagcgcgtcacccgtacc
tatcaagatgcgcatgccctgaccgccgacgatatcgccgaggcggtgttctgggtggca
acgctaccccctcacgtcaatatcaatacgatggagatgatgccggtctcccagtcgttc
tcacccctggcggtctatcgcggcgaatag

DBGET integrated database retrieval system