KEGG   Edwardsiella tarda EIB202: ETAE_1726Help
Entry
ETAE_1726         CDS       T01121                                 

Definition
(GenBank) chemotaxis sensory transducer family protein
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1835283..1838237)
Genome map
AA seq 984 aa AA seqDB search
MKPPRAIPFYLHIAYLFIGLLLVFSCLILWYQYHASTRLLLGTTYNHYRSVVSETANEME
QAYHSGSLLVELLANQRNDMATQPLADRLQHLPFYVTALRNSPKLAALYTGYDNGTFFLV
RRYIPSAEMIRQFDPPAGTAWMVQSQTLNGDGKITGSYLFYNDKLTLLEQRGVAAYRFDP
RMRNWYQMASDPGMLHSTSPYRFASGGLLGITLAARMVNAPGVAGSDIQLNGLDAMLQAA
RITPNSHLVLLNAQGQILASDLGLPGLLTNSLGIVHLPTLADTDNPQLLPLAQLSRMPPL
QPVSLDLANGERWEGMPFTFKVLGGETLRLLMASPTAELMASARQDVGQMLRISLLILGL
GLIGAIWLAHRASKPLNQLVNEVKKIEEFRFDEPVNVQSNIVEIYRLAKAFGKMKESIDH
FMAISLALVGERHQPVLLARILAEMTSQTHAMGGLILLSQQGGLHPVQSRWQETTTTIDE
RHTWVSAAGMGLLQRMQQQQLIRRTIDPPTLAAAFPAFPPTIRPLTLLLLPLRNAAQESL
GLLILFIDHQHFPVSSRMLAFAQALAGTAAVALNTQRLLDEQKRLLEDFIRIIAGAIDAK
SPHTGEHCQRVPVLAKLLAQAACDQKQGPFADFSLSDDEWEALRIAAWLHDCGKVTTPDS
VMEKATKLETLYDRIHEIRMRFELLKRDADVAYWQGMAEGGDPTTLARVRDTLKLQLDEE
FAFVAACNRGSESLSPEAIERLRAIALRTWTRTLSDRIGLSADETQRKQATPESPLPVNE
PLLADRAEHLLPRHGNELLEAYRQQGFTMDIPQYQYHHGELHNLTIVHGTLTDEERFKIN
EHIIQTILMLNQLTFPRHLQQVPNIAGSHHEHIDGSGYPRGLIRSQMSIQACIMAVVDIF
EALTASDRPYKPAKTLSQTLTIMSEMCRREHIDADVFCLFLQSGVYLDYAKRYLRPEQMD
RVDIAMLINNCRGKSDRSAEASSV
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctccgcgcgcgattcccttttatttgcatattgcctatctgtttatcggactg
ctgctggtcttctcttgcctgatcctatggtatcaatatcacgccagcacccgcctgctc
ttggggacgacgtacaatcattatcgcagcgtcgtcagtgaaaccgcgaatgaaatggag
caggcctaccacagcggctcgctgctggtcgagctgctggctaaccagcgcaacgatatg
gcgacgcagccattggcagatcgcctgcagcatctgccgttctatgtcaccgcattacgc
aatagtcctaaactagccgcgctctataccggctatgataacggcacgttttttctggtc
cgtcgctatattccgtcggctgaaatgatccgccagttcgatccgccggcgggaaccgcc
tggatggtacagagccaaacgctgaacggcgatggcaaaataacgggaagctacctgttt
tataatgataaattaaccctcctggaacagcgcggcgtcgccgcctatcgttttgatccg
cgcatgcgtaactggtatcagatggccagcgatccgggcatgctgcacagcacctcgcca
taccgctttgccagcggcggcctgctggggatcacgctcgcggcacgcatggtcaacgcc
cccggcgttgcaggcagcgatattcagcttaatggattagatgcgatgctgcaggcggcg
cgcattacgcccaacagccatctggtcctcctcaacgcccaggggcaaatcctcgccagc
gatctgggactgcctggactactgaccaacagcctgggtattgtccaccttcctacgttg
gccgataccgacaacccgcagctgctcccgctggcccagcttagccgtatgccgccctta
cagcccgtctcgctggatcttgccaacggcgaacgctgggaaggtatgccctttaccttt
aaggtattagggggagaaacgctgcgcctgctgatggcctcgcctacggcggagctgatg
gccagcgcccgacaggacgtcggccaaatgctgcggatctcgctgctgatccttgggttg
gggctgatcggcgcgatatggctggcgcaccgcgcatccaagccgttgaatcagctggtt
aatgaagtcaagaagatcgaagagttccgctttgatgagccggtcaatgtgcagagtaac
atcgttgaaatttatcgtctggccaaagcattcgggaaaatgaaagagagcatcgaccac
tttatggcgatctctctggcgctggtcggcgaacgtcaccagcccgtactattggcgcgg
atcctggccgaaatgaccagccagacccatgcgatggggggattaatcctgctatctcag
cagggggggctgcacccggttcagtcgcgctggcaggaaacaaccacgacaatcgatgaa
cgtcatacctgggtctctgctgccgggatgggcctgctccagcgaatgcagcagcagcag
ctcatccggcgcactatcgatccgcctacgctagcggcggcctttccggcgtttcccccg
acgatccggccgctgactctgctactgctccccttgagaaacgccgcgcaagagtccctg
gggctgctgatcctgttcatcgatcatcagcactttcccgtctcatcgcgtatgctggcc
ttcgcccaggcgctggccggaacggccgccgtcgcgctgaatacccagcgcctgctggat
gagcaaaagcgcctgctggaggattttattcgtatcatcgccggcgccatcgatgcgaag
agtccgcataccggagagcattgccagcgggttcccgtgctggccaagctgctggcacag
gcggcctgcgaccaaaaacagggcccctttgctgacttctctctctctgacgatgagtgg
gaggcgctgcgcatcgccgcttggctacacgactgcggcaaggtgacgacgccggactcc
gtgatggaaaaggccaccaagctggagaccctgtatgaccggattcatgagatccgtatg
cgctttgagctgctaaaacgggatgctgacgtcgcctactggcaaggcatggcggaaggc
ggcgatccgacgacgctggcgcgggtgcgcgatacgctaaaattacagctggatgaggag
tttgcctttgtcgccgcctgtaaccgcggcagtgaatccctgtcgccggaggcgattgag
cgtctgcgtgccatcgccctacgaacctggacccgcaccctttccgatagaatcgggctc
tccgccgatgagacgcagcgcaagcaagcgacgccggaatcgcccctgccggtgaatgaa
ccgctgctggccgacagagcggagcatcttctgccgcgccacggtaacgaactgctggag
gcctatcgtcagcagggatttaccatggatataccgcagtatcagtatcatcatggcgag
ctgcataatctgaccatcgtgcacggaaccttaaccgacgaggagcgctttaagatcaat
gaacacattattcagacgattctaatgctgaatcagctgacctttccccgtcacctgcag
caggtgcccaatattgccggcagtcatcatgaacatatcgacggctccggctacccacgg
gggctgatccgcagtcagatgtcgatacaggcctgtatcatggccgttgtcgatattttt
gaggcgcttaccgccagcgatcgtccctataaaccggcgaagacgctatcgcagacgctc
acgatcatgagtgagatgtgccgtcgagagcatatcgatgccgatgtattttgtctgttt
ctacaaagcggcgtctacctggactacgctaagcgctacctacgcccagagcaaatggat
cgggtcgatattgctatgctgataaataattgccgggggaaatcggatcggagcgcagag
gcctcatcggtataa

DBGET integrated database retrieval system