KEGG   Edwardsiella tarda EIB202: ETAE_1728Help
Entry
ETAE_1728         CDS       T01121                                 

Definition
(GenBank) dipeptidase
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1838999..1840486
Genome map
AA seq 495 aa AA seqDB search
MKVSSVSAASPSTMPISQDSCTTILIGAAATRDGSRIIARTEDHDPLLSKVLLKHPPKAD
QRGLFHANENAFSWPLPQTAQGYSAFANGKVGKTAAQMTWGAAGFNQRGVGMSATETIFA
SEQALLHDPYLSESGITEDSIVDIVLPYIDSARDGVSRLGKMIEEQGAGEGFGVAFIDSD
EIWYLETGSAHQWLAAKLPPHGYFVTGNQGRLRDYDPDDHDGYMASASLIDFALQHGLYD
PQREGAFNFERAYTRHDDRLDGYYNYPRVYALQQLYRPDPDRTLQQPQQFAVFEAPSAAL
DVESVKRGLRNTYDNLGRQPYADTPDYTWRPISLFRTQQSHILQSRSGLPRALSDVIYLS
YGMPSISLYIPFYPNAQGDVPAAYCEVTAGEADTFSAQWQFRKLQTLVMVNYYRYAPSVQ
QAYQQLELRFSELQQAMESEYINIYQDDMDEADRLLQRFGEQVFAEALETTQRLTNQLFT
QLAQDVNAKYLFAGA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctcttctgtatctgctgcttccccatcgaccatgccgataagccaagattca
tgtaccactattctgattggcgcggcggcgacacgcgatggttcgcgtattattgcccgc
accgaggaccacgatccgctgctgtcgaaggtactgctcaagcatccgccgaaggcggat
cagcgtgggctgtttcatgccaatgaaaatgcctttagctggccgctaccccaaacggcg
cagggctatagcgcattcgctaacggtaaagtcggaaaaacggcggcgcagatgacctgg
ggcgccgccggatttaatcagcgcggcgtcggaatgagcgccaccgagacgatttttgcc
agtgagcaagccttgttacacgatccttatctgagcgagagtgggatcaccgaggacagc
attgtcgatattgttttgccctatatcgactccgcgcgggacggggtatcgcgcctgggt
aaaatgattgaagagcagggcgccggtgaggggtttggcgttgcctttatcgattcggat
gagatttggtatctggagaccggcagtgcgcaccagtggctggccgctaaactgccgccg
cacggctattttgttaccggcaatcagggacgcctgcgcgactatgatcccgacgaccac
gacggctatatggcgtcggcctcgctgatcgactttgcccttcagcatggactgtatgat
ccccagcgcgagggggccttcaattttgagcgggcctatacgcgccatgacgatcgcctc
gacggctattataactatccgcgggtgtatgccttgcagcagctgtatcgccccgatccg
gacagaacgctgcagcagccgcagcagtttgcggtattcgaagcgcccagcgctgcgctg
gatgtggaatcggttaagcgagggctacgcaacacatacgataatctggggaggcagccc
tatgcggatacgccggactatacctggcggccgatatcactgttccgcacccagcagtcc
catatcctacagtcgcgcagcggtttgccgcgcgcgctgagcgatgtgatatacctatcc
tacggtatgcccagcatttcgctctatattccgttttatcccaacgctcagggcgatgtg
ccagccgcctattgcgaggttaccgccggggaggccgatacgttctcggcgcagtggcag
tttcgcaagctgcagacgctggttatggtcaactactatcgctatgcaccgagcgttcag
caggcatatcaacaattagagttgcgctttagcgagctgcagcaggcgatggagtctgaa
tatattaatatttatcaagatgatatggatgaggccgaccgcctgcttcagcgctttggc
gagcaggtatttgcggaggcgttagagacgacgcagaggctaaccaaccagctgtttact
cagctggcgcaggatgttaacgcgaaatacctgtttgccggcgcctag

DBGET integrated database retrieval system