KEGG   Edwardsiella tarda EIB202: ETAE_1729Help
Entry
ETAE_1729         CDS       T01121                                 

Definition
(GenBank) predicted Co/Zn/Cd cation transporter
Organism
etr  Edwardsiella tarda EIB202
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1840654..1841583)
Genome map
AA seq 309 aa AA seqDB search
MNQQQHMPFCRGPDADHSREVASKRSTWISVVVNSVLTVFQIVAGVFSGSQGLIADGMHS
LSDLAADFVVLCAVQRSPRAPDVRHHYGHRRYENAASLILGGLLLAVGIGMIVSAINKLS
DPAAIPTVHYTALGVAIAALLVKEILFRYMLAVAHRVGSGMLVANAWHARSDAASSLVVA
IGIAGNLLGFGWLDPIAALIVGAIVSRMGWRFSADALHDLTDRAADAEQNDAIRRAILST
PGVIGLHALKTRKSGDLILADVHLEIDGRLSVTAGHHIASEAERRVMAEHPVLCLMTHVD
PVVCAPPRG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacagcagcacatgccgttttgccgcggccccgacgcggatcacagccgtgag
gtggccagtaaacgcagcacctggatcagcgtggtcgtcaatagtgtactgacggtgttt
cagatcgtcgccggcgttttttccggctctcaggggctgatcgccgacggtatgcattcg
ttatccgacttggcggcagactttgtcgtcctctgcgccgttcagcgcagtccgcgggcc
ccggatgttcgtcatcactatgggcatcggcgctacgagaatgcggcctctttgatcttg
ggaggactcctgttggccgtcggtattgggatgatcgtttcggccatcaataagctcagc
gatccggcggccattcctaccgtgcattacaccgcactcggcgtggcgatagctgcactg
ctggtgaaagagatactctttcgctacatgctcgccgtcgcccatcgggttggctctgga
atgctggtcgccaacgcctggcatgcccgatcggacgccgcctcatcgttggttgtcgcc
atcgggatcgctggaaatctgctggggtttgggtggctcgatcccatcgcagcgctgatc
gtcggggcaatcgtgagccgtatgggatggcgctttagcgcggatgcgctgcatgattta
accgatcgggccgccgacgctgagcagaatgatgccatccgacgggctattttatctacg
cccggggtcatcggactgcatgcgctaaaaacccgcaaaagcggcgatctgatcctggcc
gatgtccatctggaaattgacggccggcttagcgtcaccgcgggacatcatatcgccagc
gaggcggagcgcagagtgatggcagaacatccggtgctgtgtctgatgacgcacgtcgac
cccgtcgtttgcgcaccccctcgcggttaa

DBGET integrated database retrieval system